Conserved Protein Domain Family
TIGR02935

?
TIGR02935: TIGR02935 
probable nitrogen fixation protein
Members of this protein family, called DUF269 by pfam03270, are strictly limited to nitrogen-fixing species, although not universal among them. The gene typically is found next to the nifX gene (see TIGRFAMs model TIGR02663). [Central intermediary metabolism, Nitrogen fixation]
Statistics
?
PSSM-Id: 131981
View PSSM: TIGR02935
Aligned: 10 rows
Threshold Bit Score: 204.89
Threshold Setting Gi: 34483455
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27350001   13 DAPFLIELVKLWRAQDTNEAWEGKSDLDLLEPYILnrERRRALPIIGDPDPNTLWRLELFFNAVGLSVERETGIMVQPIL 92
gi 34483455    2 EGVFKQALIDQFRALDAYGHWNRLSDEELLGRLYI--REKGASATCAEVDEATTRNIKLYYQALAVAFEKRCGEMANVMM 79
gi 283775563   5 NSPFMRMLITRIRAEDSFGAWENKQDAALLSEYIVtkEERRAIPIIGDPDPEIIDRIDYFYQAVALAIEEKSGQMAVPIL 84
gi 71846761   12 QTDFVKEMARQMRALDTYGTYQGWTVEKILDPYVLtkERKAEIPLIGDPDDETISRVKAFYNAIAVLIEKECKLLAVPLV 91
gi 14025681   18 ASPFVKCLVRLIRAQDTHGSWDGTADAELLADFIVskERRRTIPIIGDPDPDVLWRLDKFYTAVALAIEERSGLMASPMI 97
gi 39651531   13 DSLFVKELVKQLRAQDTHGVWEGKSDLKLLEPFIVdkAKRREIPIMGDPDPETLWRLELFYNAVALSIERETRIMVSPMM 92
gi 141097     15 ESPFLAQLVAVIRAEDSHGLWDDKTNSEILREFIVtaEERRSMPIIGDPDPELIWRMTKFYDAIGLLVEKRTGCMASQMQ 94
gi 77388522   15 ASDYLDQLAAIVRAQDSYGHWDGKSDAELLADYILtpEERREMPIISDPEPETIARIEKFYDAVGLLVEKRTGVMAGHMA 94
gi 82945506    7 QDPFIKNLCMFIRAQDMSGAWESMSDDDVLAPYILskEQRREIPLFGDPDPDILWRVEQYFNAIAMAIENKTGRAIAPIM 86
gi 499709204  16 ETPFVRQLVRQIRAEDTYGAWDGKPDAEVLGPFIVtaEQRREIPIIGDPDPDILWRLEIFYAAVGLTIEKATGRVASPIM 95
                         90       100       110       120       130       140
                 ....*....|....*....|....*....|....*....|....*....|....*....|
gi 27350001   93 KLHHEGFGRIVLIAGRLVAVNKQLRDVHRLGFDNCVKLAQEGDRYVSEGIGLIRKFPDVA 152
gi 34483455   80 ELNSEGYGRILVIVGRLIVLDKTIRDASKFGFGSLEELDKKGGGALGDALKAFEKYRSIF 139
gi 283775563  85 KLNHEGFGRLFVIVGRLVVLAKSMRDVHRFGFEDMAALNQEGCRAVDNAIKIIKQFPDAA 144
gi 71846761   92 HLTHEGFGRALITVGKLVAVDRTLRDVHRFGFASLSKMKDEADKILSIAIERIGEHPAVA 151
gi 14025681   98 EMSHEGFGRVLFTAGRLVVLSKTVRDVHRFGFETFCKLAAAGTKLVDDAIAAIDAYPEVA 157
gi 39651531   93 KMHHEGFGRLILSAGRLIVINKHMRDVHRFGFDNLAKLAEEGDKLVAAGSEMIRKYPDVA 152
gi 141097     95 KMHHEGFGRVVLIAGKLVVVSKHLRDVHRFGFETWAKLAEAGEKLVESAVATINEFPEAA 154
gi 77388522   95 KFHHEGFGRVVLIGGSLVLVSKHMRDVHRFGFASYEKLAEAGEKLASAAVRKIEAHPEAA 154
gi 82945506   87 KIHHEGWGRMILTAGKLVAVNSYMRELHRFGFDSVEAMSAKAQKLIDEGVATIEKYPDVA 146
gi 499709204  96 KMSHEGFGRMLLTTGKLVVINAYLRDIHRFGFPSLSKLAEKGAKLVAEGLAAIEAFPDAA 155
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap