Conserved Protein Domain Family
nifL_nitrog

?
TIGR02938: nifL_nitrog 
nitrogen fixation negative regulator NifL
NifL is a modulator of the nitrogen fixation positive regulator protein NifA, and is therefore a negative regulator. It binds NifA. NifA and NifL are encoded by adjacent genes. [Central intermediary metabolism, Nitrogen fixation, Regulatory functions, Protein interactions]
Statistics
?
PSSM-Id: 131984
View PSSM: TIGR02938
Aligned: 3 rows
Threshold Bit Score: 856.895
Threshold Setting Gi: 71846741
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1352501   22 LLPEIFRQTVEHAPIAISITDLKANILYANRAFRTITGYGSEEVLGKNESILSNGTTPRLVYQALWGRLAQKKPWSGVLV 101
gi 53758675  16 LPSSLMRATVDQAPVAISITDLKANILYVNAAFSEITGYAPQECIGRNESMLSDRRTPPEVYQELWGCITRQQPWRGRLL 95
gi 71846741  40 LPPEAYRQAVDQADLAISITDDKANILFANDAFTRVTGYTKEEIIGKNESVLSNHTTPPEVYQALWKSLAEQKPWAGKLL 119
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1352501  102 NRRKDKTLYLAELTVAPVLNEAGETIYYLGMHRDTSELHELEQRVNNQRLMIEAVVNAAPAAMVVLDRQHRVMLSNPSFC 181
gi 53758675  96 NRHRDGRRYLADLTVAPMLNEAGETTHFIGMHRDVTEEYLLQQQVRQQTLFLETVVASIPVSAVLIDENGRIVLDNLMYK 175
gi 71846741 120 NRRKDGELYLAELSISPVVDATGTTTHFLGMHRNITELHRLERVVANQKHLIESVVDAAPVAFALLDPTGRVILDNQEYK 199
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1352501  182 RLARDLVEDGSSESLVALLRENLAAPFETLENQGSAFSGKEISFDLGG-RSPRWLSCHGRAIHIENEQAHVFFAPTEERY 260
gi 53758675 176 ALASDLKVEEPALLFLKLLREESGEDWNDFWHREKAFRNLELRFDPGGgRPSRWFSCAGQWFRHEEGSVDGFFSGSEKGY 255
gi 71846741 200 KLVTDLRVKEPAHTVLDSLLPAWREALAEN-PQQLVVSNREARIDRAAgR-ARWLSVTSSVIGMHSDCADSYFCAAGQPG 277
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1352501  261 LLLTINDISELRQKQQDSRLNALKALMAEEELLEGMRETFNAAIHRLQGPVNLISAAMRMLERRlGDKAGNDPVLSAMRE 340
gi 53758675 256 LLLTVDDITQQKKQQEQYRLRGLQALMAEEEKLESLKETLFAAIHQIQGPLNLIGAAKNILDRR-GDDAGNVALRDLLQQ 334
gi 71846741 278 LLLVIADVSNLREEQERARASALQAVLAEEERTAAIREGLSAAIFRLEEPMNVMSSAISVLQRR------DPASAAMLQQ 351
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1352501  341 ASTAGMEALENLSGSIPVRMAESKMPVNLNQLIREVITLCTDQLLAQGIVVDWQPALRLPWVMGGESSQRSMIKHLVDNA 420
gi 53758675 335 VMAAGEASICTLEKCIPHSDNNAFKPVNLNQVLHDAITLLTERLLASGIVVEWVPTPVLPSLKGSENRLRSLFKQLIENA 414
gi 71846741 352 ALSGSREHMEALRQVIPQSPQEIVVSVNMNEILRDVLEVSTPRLLAAGIIVDWQPAATLPAILGRPLQLRMLFKALVDNA 431
                       410       420       430       440       450       460       470       480
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1352501  421 IESMSQNqvSRRELFISTRVENHLVRMEITDSGPGIPPDLVLKVFEPFFSTKPPH-RVGRGMGLPVVQEIVAKHAGMVHV 499
gi 53758675 415 IDAMAHS--RRRELRILTWTRDQLIHITIEDTGPGIPAGLRTQVFEPFFTTKASLgRQHVGMGLAVAHEIVNQHNGLIRI 492
gi 71846741 432 IEAMNIKgwKRRELSLTSALNGDCIVVSVLDSGPGIPQDWRYKAFEPFFTAKGGS-GKHIGTGLSRAQQVVADHGGIIDL 510
                       490
                ....*....|....*.
gi 1352501  500 DTDYREGCRIVVELPF 515
gi 53758675 493 DPDYQEGCRIHMQFEI 508
gi 71846741 511 DDSPSGGCAAIVEFRV 526
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap