Conserved Protein Domain Family
SUF_assoc

?
TIGR02945: SUF_assoc 
FeS assembly SUF system protein
Members of this family belong to the broader pfam01883, or Domain of Unknown Function DUF59. Many members of DUF59 are candidate ring hydroxylating complex subunits. However, members of the narrower family defined here all are found in genomes that carry the FeS assembly SUF system. For 70 % of these species, the member of this protein family is found as part of the SUF locus, usually immediately downstream of the sufS gene. [Biosynthesis of cofactors, prosthetic groups, and carriers, Other]
Statistics
?
PSSM-Id: 131990
View PSSM: TIGR02945
Aligned: 15 rows
Threshold Bit Score: 152.455
Threshold Setting Gi: 39935534
Created: 8-Oct-2014
Updated: 11-Oct-2014
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 500954086  19 PLERAVIEALKSVYDPEIPVDIYELGLIYHIDCDTvA-KKVIVYMTLTAPGCPVAGVMPDWVKEAIEKVDGVSDCTVEMV 97
gi 499248803  24 SIKEGVITALRGVFDPEIPVNIYDLGLIYDIAVND-E-GHVHIQMTLTTPGCPVAQTFPGTVEQAVNQVEGVSDCTVELV 101
gi 499559559  46 KLKAEIIETLRDIYDPEIPVNIYDLGLIYDIEIGD-D-NHVVIKMTLTTPNCPVAGSMPAEIELRVGQIKGVGAVEVELV 123
gi 499570910  24 PDQEAVIAAIATVYDPEIPVNIYELGLIYAIDLHD-D-GRIHIEMTLTAPNCPSAQELPEMVRDVVSHVPGVTQATVEIV 101
gi 500008596   2 TVKDQIFAALKKVYDPEMPVNIVELGLIYGIEVDD-A-GQVDVRMTLTAPNCPVAGSLPAEAERAIRSVPGVTGVKLELT 79
gi 499860245  59 DLYEAVIAALKDIYDPEIPVNIYDLGLIYNVEIDE---GHVMVTMTLTTPHCPVAESMPGEVELRVGAVPGVGDAEVNLV 135
gi 499903631  10 ELKNKALEAIQTVYDPEIPVNIFELGLIYEVSVFP-V-NNIFVQMTLTSPNCPAAQSMPAEVENKIKAIEGVNEVTVEIT 87
gi 499804421  29 GLQARVIEALRGVFDPEIPVNIYDLGLVYGLDVDE-AlGKVHIRLTLTAPGCPVAQTFPEVVGSTVDGVPGVNEVEVELV 107
gi 499723400  38 DLYQRVVESLREIYDPEIPVNIYDLGLIYHLDVGE-D-SHVDVLMTLTAPNCPAAGVLPGQAEDAVRETEGVESVNLEMT 115
gi 499709585  34 asRDAVIDSLQEIYDPEIPVNIYDLGLIYEIEIDD-H-GDCKILMTLTAPACPVAGTLPGETAEKVATLEGIGRVEVNLT 111
                         90       100
                 ....*....|....*....|.
gi 500954086  98 WDPPWTMEMMSLRAKIDLNMI 118
gi 499248803 102 WEPPWSQDRMTEAARLELGIF 122
gi 499559559 124 WDPPWGMDRISDEAKLELGLL 144
gi 499570910 102 WDPPWDMSRMSDDARLALNMF 122
gi 500008596  80 FDPPWTKARMSEAAKLACGIe 100
gi 499860245 136 WDPPWSPANMSDEARLELGML 156
gi 499903631  88 FDPTWSQEMMSDAAKLELGFM 108
gi 499804421 108 WQPPWSKGMMSEAARLQLGLL 128
gi 499723400 116 FEPPFSPQMMSEEARLELGFM 136
gi 499709585 112 WEPPWTPERMSEVARVALDMF 132
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap