Conserved Protein Domain Family
TMAO_TorT

?
TIGR02955: TMAO_TorT 
TMAO reductase system periplasmic protein TorT
Members of this family are the periplasmic protein TorT which, together with the the TorS/TorR histidine kinase/response regulator system, regulates expression of the torCAD operon for trimethylamine N-oxide reductase (TMAO reductase). It appears to bind an inducer for TMAO reductase, and shows homology to a periplasmic D-ribose binding protein.
Statistics
?
PSSM-Id: 132000
View PSSM: TIGR02955
Aligned: 6 rows
Threshold Bit Score: 466.166
Threshold Setting Gi: 73855028
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 46912852  57 KICAVYPHLKDSYWLSINYGMVEQAKILGITLKVLEAGGYPELEKQKGQLQYCKKWGADAIILGTVDRTAYNGILSQFTG 136
gi 9658129   47 KLCALYPHLKDSYWLSVNYGMVEEARKLNLNLRVMEAGGYPNHHKQQQQIALCVRWGADAILLGTVSPELYQDDLAHYTR 126
gi 59480328  28 KLCAIYPHLKDSYWLSVNYGMVKEAKAQHVELTVYESGGYPNVERQTQQIEQCVLNGSDAIILGTVDPMAFQANLITLTK 107
gi 73855028  46 KLCALYPSLKDSYWLSLNYGMQEAARRYGVDLKVLEAGGYSQLATQQAQIDQCKQWGAEAILLGSSTTSF--PDLQKQVA 123
gi 71147126  54 KLCAVYPHLKDSYWLSINFGMTEQAKQRSIELKVLDAGGYQNKDEQLRQIEQCIHWQASAILVGSVNFEALNQKLAQVNK 133
gi 24346904  60 RLCVLVPHLKDAYWIGIDYGLIQHAKHLGVSLDLFEAGSYYHQDKQLAQLRSCMSGDYDAILLGAVSPNLLEHFPLPLSK 139
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 46912852 137 DIPVFSMTNDIDMSDpeikmhIKAKVGVDWYYMGKQAGVFLAQ-RHPK--GSGKMKVAWLPGPKQRGGTKAVTTGFYDAL 213
gi 9658129  127 SVPVFATVNQLRLNEqqq-ehLKGEVGVDWYWMGFYAGEYLAR-KHPK--GSGEIKIVVLPGPASSGGTKPVLQGLEEAI 202
gi 59480328 108 GIPVFATVNQLISSYppatpvHHGEVGVDWYEMGYKTGEFLAK-RHPK--DSGITYIGWLPGPKTRGGTKPVTQGFNDAI 184
gi 73855028 124 SLPVIELVNAIDAPQ------VKSRVGVPWFQMGYQPGRYLVQwAHGK-----PLNVLLMPGPDNAGGSKEMVEGFRAAI 192
gi 71147126 134 HTPVFALVNEIATNN------ISGRTGVSWYQMGYQLGEYLVK-HHQNnfNTTPATLAWFPGPKRGGGSLQSTKGLQAAL 206
gi 24346904 140 --PIIALVNKLNSDQ------VLTHIGVNWYQMGLRAGQFIKA-DAKVhtPTQPTTLALLAGPENVGGTDLVEQGIRHAL 210
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 46912852 214 QDSDIEVVSTLWADNSKELQRNLIQQLFtEHPDINYIVGGAVAAEVAISELRTNHRTDDVKIISTYLSHGVYRGLRRGKI 293
gi 9658129  203 SHSDVRITEILWADNDKELQRNLIQQAL-EQPDVRYLVGSAVAIEAAISELRSLNKSDQIGLIATYLSHGVYRGLLRGRV 281
gi 59480328 185 KDSDIIVSATYWGDNSKELQRNLIQDAL-QTEKLDYLVGGAVAIEVAISEVASRKMQNQVGLVSTYLSHAVYRGLLRNRV 263
gi 73855028 193 AGSPVRIVDIALGDNDIEIQRNLLQEMLeRHPEIDVVAGTAIAAEAAMGE--GRNLKTPLTVVSFYLSHQVYRGLKRGRV 270
gi 71147126 207 VNSPIEIIAIEHGLNEKITQFSLLKDTLkKYNNIDYLAGNAVMAEMAINEVGRLPKEQQPEILSHYLSHGVYRGIKRHKI 286
gi 24346904 211 EGSNVSISAIQHADNNRNLYRDQLQILL-KAQQPNYILGSAVAIEAAVSTLKQKHMTQDIKLVSSYLSPAILRGLKRQKV 289
                       250       260       270       280       290       300
                ....*....|....*....|....*....|....*....|....*....|....*....|....
gi 46912852 294 LFSPTDKMAQQAQMSIDQAVRYLENKPMEFDLAPKIQPLTPEYLPREVITDSLSPAEYRPVFNV 357
gi 9658129  282 EFAPTDQMVEQGRLSVRQAAAFLRNKPYAIQQAPKIEALTPQHLERKIIADSLSPSEYRPVFQV 345
gi 59480328 264 LFSPTDKMVLQGQLSIQQAVSYLNKHPLSFQLSPKIEALTPQHLPKKVLEESLSPAEYRPTFFV 327
gi 73855028 271 IMAASDQMVWQGELAVEQAIRQLQGQSVSDNVSPPILVLTPKNADREHIRRSLSPGGFRPVYFY 334
gi 71147126 287 LMANSDQMVLQGKMAINQAVDYLKIGKVKTLQAPTIITIDQATIKKLKTELSLSPSNFKPIYSI 350
gi 24346904 290 LYSNDDLVVLQGKLAIDVAVKQLEGATPFGDIGPAIVGRTMSANTQSELSFSLAEADFYPLYQV 353
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap