Conserved Protein Domain Family
SigX4

?
TIGR02957: SigX4 
RNA polymerase sigma-70 factor, TIGR02957 family
This group of sigma factors are members of the sigma-70 family (TIGR02937). They and appear by homology, tree building and bidirectional best hits, to represent a conserved family. This family is found in a limited number of bacterial lineages. This family includes apparent paralogous expansion in Streptomyces coelicolor A3(2), and multiple copies in Mycobacterium smegmatis MC2, Streptomyces avermitilis MA-4680 and Nocardia farcinica IFM10152.
Statistics
?
PSSM-Id: 132002
View PSSM: TIGR02957
Aligned: 9 rows
Threshold Bit Score: 380.931
Threshold Setting Gi: 29604549
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 77968832    6 QTFRALRPRLQKIAYRMLGSVADAEDIVQDVWLRWHEA-ARDSIENTEAWLVSVTTRTSIDRLRAAKIRREHYTGIWLPE 84
gi 10173286    6 EDYEQLKPLLFSLGYRLLGSVTDAEDLVQETFLRAYQA-EEREINNKKAYLCKMMTNRCLDVLKSARRKREQYVGPWLPE 84
gi 51976501    5 QLYEAYQPLLFSLAYRILGSVMDAEDIVQDVFISLNNIeDLQSIENMKAYLCKMATNRSIDKLRSAAYKRNVYVGMWLPE 84
gi 52005855    2 EYYRQYHSLLFSIAYRMLGSFQDAEDIIQELFADLQEK-DIGQIDHIQAYLTKSITNRCINELQSARKKREVYIGEWLPE 80
gi 35211231   12 ETFQQHRGMLFAIAYRMLGTVADAEDMVQETFLRWQQA-SAAGVQSQKSYLAAVVTRLSIDHLRSARVRREQYVGPWLPE 90
gi 6714789    29 EAFVTHRNLLFTVAYEMLGSAADAEDVLQETWLKWAGV-DLDTVRDRRAYLVRITTRQALNRLRTLGRRKESYVGSWLPE 107
gi 29604549    5 EEFEELRPLLFSVAYRILGSVSEAEDAVQETWLRYEL--SPARPASARAFLSAVVTRVSIDVLRSARMRREEYVGPWFPE 82
gi 54018761    7 REFQAHRPRLFALAYRMLGSATEAEDAVQETYLRWAGA-DRSQIRTPEAWLTTAVVNLCRTWLVSARARRESYVGPWLPE 85
gi 500047114  21 AVFTRVRPRLFGVAYRMTGTVAEAEDAVQEAWLRWQDT-DRAAVTDPVPFLMTVVTRICLNVLQSARARHETYIGPWLPE 99
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 77968832   85 PEFGEsPATPEEMTERADDVSVAYLLLLERLTPEARAAFLLREVFDADYDEIADAIGKSEAACRQLVSRAKAQLrDDDRP 164
gi 10173286   85 PLLIT-SDDPSEAILQKEGLSMAYLRMMEHLTPHERAVFLLREVFTFSYREIASMMEKKEDNCRKLYSRAKEKL-SAVKG 162
gi 51976501   85 PLVEE-SNEPSESFAMKESLSTAYLLLLQQLSEVERIVFILREVFSYEYEEIASIVDKSSVNCRKIFQRARKSI-LDKPK 162
gi 52005855   81 PQVALsAQIPAEYVEEKEKVSYAFLVVMSRLNPVERAVLMFREVFGYHYKEISSIIGKSEANCRQIHSRLKQKL-NEDIS 159
gi 35211231   91 PLAQT-AADPLQQSELADSLSMAFLVLLESLSPLERAVFLLSEVFEYDHAEIARIVDKSPANCRQILRRARRHL-AERQP 168
gi 6714789   108 PLLTT--PDVAEDVELADSVSMAMMLVMETLAPTERAVFVLREVFDLGYDEIAEAVEKSPAAVRQIAHRARAHV-AARRP 184
gi 29604549   83 PLLTDpYEDPEQSAELADSLSMAALLLLERLSPLERAVFVLREVFAFGFPEIASAVGRSEAACRQLAVRARRHM-DAGRP 161
gi 54018761   86 PVPTA-ELGPLETVELRESVSLALLTALERLNPLERAVFVLHAAFGYPHREIAEMLDVSDSAAQQAYHRATQRV-RLGRN 163
gi 500047114 100 PVDTT--ADPALGAERGAALELATLMLLERLAPPERAAYILREAFDYPYEQIAETVGVSVPNARQLVSRARRRV-TTRRA 176
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 77968832  165 rHIVPRETHRQLLQTFSHALAQGDFPSIQALLAEDAMLIGDGGGKVQSFPKPMVGGRRIAQLFYATWLRCGS-GVEMRPV 243
gi 10173286  163 -ESLHYENNRSVVDRFIHSFQTEDQGDLLELLSDHVTLYTDGGGKVRAALRPIYTKDHVAAFLFGIAKKRPN-DFYVEVK 240
gi 51976501  163 qSTLSTKKMAAYVEKFVSSLQCGDAQGMLEVLKTDAVLKADGGGKVTTAIHPIYSADRIIRLFFGIVQRLTK-EYTVDFK 241
gi 52005855  160 -VFSQPVEEQQLAQLFIESAKTGNFEEFSKKLIEDAVLYTDGGGKVRSALRPIYGKSRIYAFFTGVVSKGSF-SGRFMPV 237
gi 35211231  169 rFRSSRPHSEKLVARFLQACSGGDLEGLLAVLAPEVTLVGDGGGKVAATIRPLQGAARVARFFVALRRRVG--HFTLMPT 246
gi 6714789   185 rGAVSATESREALAAFQRAVETGDLQGLLDILSPDVVLLGDGGGIKQAVLRPVVGADKVARLMLGGLVKLDM-EMRMDPA 263
gi 29604549  162 rFEADRKEREELAERFFEALREGNVDGLRELLAADVSLVGDGGGKAPQWARGFFGVGQVSQMLATLFPPFFRiGGVVDPH 241
gi 54018761  164 rFEVSAERARALLERFLVAASTGDVAALRSLLTADATATADGGGVINAARRPVEGADRVARYLLGLFRRQVP-GMVIGVE 242
gi 500047114 177 -APVATAEQDRLLRAFVTAARSGDLDALEEILAEDVVSHTDGNGARNAAQIPVVGRTTVAKFVRAFRNRLWP-GASLRWI 254
                        250       260       270       280
                 ....*....|....*....|....*....|....*....|....*...
gi 77968832  244 VLNDEWAMLRF-IAGQLESAMAFET--DGTRIVRILVQRNPDKLARIA 288
gi 10173286  241 NVNGQPALISY-ADSKLYNVICFYI--VGGQIQDIYIIMNPEKLPSNG 285
gi 51976501  242 MVNGMPGVIVT-INNKITYVLSFAF--EDEKISNIYMVVNPEKLMHLN 286
gi 52005855  238 DINDQKGVLIM-KNNRPAYAVCFAWnpEGDSVKNVFIVSNPDKLKHIK 284
gi 35211231  247 VINGQSGIAFL-VAGNLQSAMTFDI--TEAGIQTIYSVRNPEKLQRFA 291
gi 6714789   264 QVNGHPALVIR-LDGELDTVVAVRL--DEGRITGLYAVRNPEKLSYMR 308
gi 29604549  242 QVNGQPGALFRdRDGKVLNTWTLDI--LGGQIQAIRTVSNPDKLGHLG 287
gi 54018761  243 DANGAPALVVR-VAGAPMLVVGIDY--TEHGIAAVRLVVNPAKLAAFG 287
gi 500047114 255 TANGHSAVLVV-HDDSPAAFLTVAA--SADGIHRLLWVLAPEKLAGIA 299
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap