Conserved Protein Domain Family
mam_aldehyde_ox

?
TIGR02969: mam_aldehyde_ox 
aldehyde oxidase
Members of this family are mammalian aldehyde oxidase (EC 1.2.3.1) isozymes, closely related to xanthine dehydrogenase/oxidase.
Statistics
?
PSSM-Id: 132014
View PSSM: TIGR02969
Aligned: 3 rows
Threshold Bit Score: 2895.48
Threshold Setting Gi: 20981678
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 215273968    5 SELLFYVNGRKVIEKNVDPETMLLPYLRKKLRLTGTKYGCGGGGCGACTVMISRYNPITKRIRHHPANACLIPICSLYGA 84
gi 20981678     5 PELLFYVNGRKVVEKQVDPETMLLPYLRKKLRLTGTKYGCGGGGCGACTVMISRYNRVTKKIRHYPVNACLTPICSLYGA 84
gi 20978407     4 PQLLFYVNGQKVVENNVDPEMMLLPYLRKNLRLTGTKYGCGGGGCGACTVMISRYNPSTKSIRHHPVNACLTPICSLYGT 83
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 215273968   85 AVTTVEGIGSTHTRIHPVQERIAKCHGTQCGFCTPGMVMSIYTLLRNHPEPTLDQLTDALGGNLCRCTGYRPIIDACKTF 164
gi 20981678    85 AVTTVEGIGSTTTRLHPVQERIAKFHGTQCGFCTPGMVMSMYALLRNHPEPTLDQLADALGGNLCRCTGYRPIIEAYKTF 164
gi 20978407    84 AVTTVEGIGNTRTRLHPVQERIAKCHSTQCGFCTPGMVMSMYALLRNHPEPSLDQLTDALGGNLCRCTGYRPIIDACKTF 163
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 215273968  165 CKTSGCCQSKENGVCCLDQGINGLPEFEEGSKTSPKLFAEEEFLPLDPTQELIFPPELMIMAEKQSQRTRVFGSERMMWF 244
gi 20981678   165 CKTSDCCQNKENGFCCLDQGINGLPEVEEENQTRPNLFSEEEYLPLDPTQELIFPPELMTMAEKQPQRTRVFSGERMMWI 244
gi 20978407   164 CRASGCCESKENGVCCLDQGINGSAEFQEGDETSPELFSEKEFQPLDPTQELIFPPELMRIAEKQPPKTRVFYSNRMTWI 243
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 215273968  245 SPVTLKELLEFKFKYPQAPVIMGNTSVGPEVKFKGVFHPVIISPDRIEELSVVNHAYNGLTLGAGLSLAQVKDILADVVQ 324
gi 20981678   245 SPVTLKALLEAKSTYPQAPVVMGNTSVGPGVKFKGIFHPVIISPDSIEELNVVSHTHSGLTLGAGLSLAQVKDILADVVQ 324
gi 20978407   244 SPVTLEELVEAKFKYPGAPIVMGYTSVGPEVKFKGVFHPIIISPDRIEELSIINQTGDGLTLGAGLSLDQVKDILTDVVQ 323
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 215273968  325 KLPEEKTQMYHALLKHLGTLAGSQIRNMASLGGHIISRHPDSDLNPILAVGNCTLNLLSKEGKRQIPLNEQFLSKCPNAD 404
gi 20981678   325 KVPEENAQTYRALLKHLGTLAGSQIRNMASLGGHIISRHLDSDLNPLLAVGNCTLNVLSKEGERQIPLDEQFLSRCPEAD 404
gi 20978407   324 KLPEETTQTYRALLKHLRTLAGSQIRNMASLGGHIVSRHLDSDLNPLLAVGNCTLNLLSKDGKRQIPLSEQFLRKCPDSD 403
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 215273968  405 LKPQEILVSVNIPYSRKWEFVSAFRQAQRQENALAIVNSGMRVFFGEGDGIIRELCISYGGVGPATICAKNSCQKLIGRH 484
gi 20981678   405 LKPQEILASVHIPYSRKWEFVLAFRQAQRKQNALAIVNSGMRVFFGEGDGIIRELAISYGGVGPTIICAKNSCQKLIGRS 484
gi 20978407   404 LKPQEVLVSVNIPCSRKWEFVSAFRQAQRQQNALAIVNSGMRVLFREGGGVIKELSILYGGVGPTTIGAKNSCQKLIGRP 483
                         490       500       510       520       530       540       550       560
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 215273968  485 WNEQMLDIACRLILNEVSLLGSAPGGKVEFKRTLIISFLFKFYLEVSQILKKMDPVHYPSLADKYESALEDLHSKHHCST 564
gi 20981678   485 WNEEMLDTACRLILDEVSLPGSAPGGKVEFKRTLIISFLFKFYLEVSQILKRMAPGLSPHLADKYESALQDLHARYSWST 564
gi 20978407   484 WNEEMLDTACRLVLDEVTLAGSAPGGKVEFKRTLIISFLFKFYLEVLQGLKREDPGHYPSLTNNYESALEDLHSKHHWRT 563
                         570       580       590       600       610       620       630       640
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 215273968  565 LKYQNIGPKQHPEDPIGHPIMHLSGVKHATGEAIYCDDMPLVDQELFLTFVTSSRAHAKIVSIDLSEALSMPGVVDIMTA 644
gi 20981678   565 LKDQDVDARQLSQDPIGHPVMHLSGVKHATGEAIYLDDMPAVDQELFMAFVTSPRAHAKIVSTDLLEALSLPGVVDIVTA 644
gi 20978407   564 LTHQNVDSMQLPQDPIGRPIMHLSGIKHATGEAIYCDDMPAVDRELFLTFVTSSRAHAKIVSIDLSEALSLPGVVDIITA 643
                         650       660       670       680       690       700       710       720
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 215273968  645 EHLSDVNSfcffTEAEKFLATDKVFCVGQLVCAVLADSEVQAKRAAKRVKIVYQDLEPLILTIEESIQHNSSFKPERKLE 724
gi 20981678   645 EHLQDGNT----FYTEKLLAADEVLCVGQLVCAVIAESEVQAKQAAKQVKIVYEDLEPVILSIEEAIEQKSFFEPERKLE 720
gi 20978407   644 DHLQDATT----FGTETLLATDKVHCVGQLVCAVIADSETRAKQAAKHVKVVYRDLEPLILTIEEAIQHKSFFESERKLE 719
                         730       740       750       760       770       780       790       800
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 215273968  725 YGNVDEAFKVVDQILEGEIHMGGQEHFYMETQSMLVVPKGEDQEMDVYVSTQFPKYIQDIVASTLKLPANKVMCHVRRVG 804
gi 20981678   721 YGNVDEAFKVVDQILEGEIHMGGQEHFYMETQSVLVVPKGEDQEMDVYASTQFPKYIQDMVAAVLKLPVNKVMCHVKRVG 800
gi 20978407   720 CGNVDEAFKIADQILEGEIHIGGQEHFYMETQSMLVVPKGEDGEIDIYVSTQFPKHIQDIVAATLKLSVNKVMCHVRRVG 799
                         810       820       830       840       850       860       870       880
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 215273968  805 GAFGGKVLKTGIIAAVTAFAANKHGRAVRCVLERGEDMLITGGRHPYLGKYKAGFMNDGRILALDMEHYSNAGASLDESL 884
gi 20981678   801 GAFGGKVFKASIMAAIAAFAANKHGRAVRCILERGEDMLITGGRHPYLGKYKAGFMNDGRIVALDVEHYSNGGCSLDESL 880
gi 20978407   800 GAFGGKVGKTSIMAAITAFAASKHGRAVRCTLERGEDMLITGGRHPYLGKYKVGFMRDGRIVALDVEHYCNGGSSLDESL 879
                         890       900       910       920       930       940       950       960
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 215273968  885 FVIEMGLLKMDNAYKFPNLRCRGWACRTNLPSNTAFRGFGFPQAALITESCITEVAAKCGLSPEKVRIINMYKEIDQTPY 964
gi 20981678   881 LVIEMGLLKMENAYKFPNLRCRGWACRTNLPSNTAFRGFGFPQAGLITECCITEVAAKCGLSPEKVRAINFYKEIDQTPY 960
gi 20978407   880 WVIEMGLLKMDNAYKFPNLRCRGWACRTNLPSHTALRGFGFPQAGLVTEACVTEVAIRCGLSPEQVRTINMYKQIDNTHY 959
                         970       980       990      1000      1010      1020      1030      1040
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 215273968  965 KQEINAKNLIQCWRECMAMSSYSLRKVAVEKFNAENYWKKKGLAMVPLKFPVGLGSRAAGQAAALVHIYLDGSVLVTHGG 1044
gi 20981678   961 KQEINAKNLTQCWNECLAKSSYFQRKVAVEKFNAENYWKQRGLAIIPFKYPRGLGSVAYGQAAALVHVYLDGSVLVTHGG 1040
gi 20978407   960 KQEFSAKTLFECWRECMAKCSYSERKTAVGKFNAENSWKKRGMAVIPLKFPVGVGSVAMGQAAALVHIYLDGSALVSHGG 1039
                        1050      1060      1070      1080      1090      1100      1110      1120
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 215273968 1045 IEMGQGVHTKMIQVVSRELRMPMSNVHLRGTSTETVPNANISGGSVVADLNGLAVKDACQTLLKRLEPIISKNPKGTWKD 1124
gi 20981678  1041 IEMGQGVHTKMIQVVSRELKMPMSNVHLRGTSTETVPNTNASGGSVVADLNGLAVKDACQTLLKRLEPIINKNPQGTWKE 1120
gi 20978407  1040 IEMGQGVHTKMIQVVSRELKMPMSSVHLRGTSTETVPNTNASGGSVVADLNGLAVKDACQTLLKRLEPIISKNPQGTWKD 1119
                        1130      1140      1150      1160      1170      1180      1190      1200
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 215273968 1125 WAQTAFDESINLSAVGYFRGYESDMNWEKGEGQPFEYFVYGAACSEVEIDCLTGDHKNIRTDIVMDVGCSINPAIDIGQI 1204
gi 20981678  1121 WAQAAFDKSISLSATGYFRGYDSNIDWDKGEGHPFEYFVYGAACSEVEIDCLTGDHKTIRTDIVMDVGYSINPALDIGQV 1200
gi 20978407  1120 WAQTAFDQSVSLSAVGYFRGYESNINWEKGEGHPFEYFVYGAACSEVEIDCLTGDHKNIRTDIVMDVGHSINPALDIGQV 1199
                        1210      1220      1230      1240      1250      1260      1270      1280
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 215273968 1205 EGAFIQGMGLYTIEELNYSPQGILHTRGPDQYKIPAICDMPTELHIALLPPSQNSNTLYSSKGLGESGVFLGCSVFFAIH 1284
gi 20981678  1201 EGAFIQGMGLYTIEELHYSPQGILYSRGPNQYKIPAICDIPAELNVTFLPPSEKSNTLYSSKGLGESGVFMGCSVFFAIR 1280
gi 20978407  1200 EGAFIQGMGLYTIEELSYSPQGILYSRGPNQYKIPAICDIPTEMHISFLPPSEHSNTLYSSKGLGESGVFLGCSVFFAIH 1279
                        1290      1300      1310      1320      1330
                  ....*....|....*....|....*....|....*....|....*....|....
gi 215273968 1285 DAVSAARQERGLHGPLTLNSPLTPEKIRMACEDKFTKMIPRDEPGSYVPWNVPI 1338
gi 20981678  1281 EAVCAARQARGLSAPWKLSSPLTPEKIRMACEDKFTKMIPRDKPGSYVPWNVPV 1334
gi 20978407  1280 DAVRAARQERGISGPWKLTSPLTPEKIRMACEDKFTKMIPRDEPGSYVPWNIPV 1333
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap