Conserved Protein Domain Family
nitrate_rd_NapE

?
TIGR02973: nitrate_rd_NapE 
periplasmic nitrate reductase, NapE protein
NapE, homologous to TorE (TIGR02972), is a membrane protein of unknown function that is part of the periplasmic nitrate reductase system; it may be part of the enzyme complex. The periplasmic nitrate reductase allows for nitrate respiration in anaerobic conditions. [Energy metabolism, Anaerobic, Energy metabolism, Electron transport]
Statistics
?
PSSM-Id: 132018
View PSSM: TIGR02973
Aligned: 8 rows
Threshold Bit Score: 58.5558
Threshold Setting Gi: 27355317
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40
                ....*....|....*....|....*....|....*....|..
gi 72121923  13 KKEELRSFLFLTAVMVPVLSVITVAGYGFIVWMSQLISGPPT 54
gi 9947101   11 KGMEARLFLFLVICLFPLLSVALVGGFGFCVWMYQLLAGPPG 52
gi 17742878  16 RTKELITFAVLAFGIWPVLAVGFVGAFGFIVWMFQIIYGPPG 57
gi 3925392   17 RRRELLTFVVLAFGIWPVVAVGTVATYGFAVWAYQIVYGPPG 58
gi 3445371   16 RRHELIVFFFLAAVIWPFLSVAFVGGYGFLIWMWQIVFGPPG 57
gi 27355317  14 RRMEIFAFLFLTAVVMPVLAVGTVGSYGLGVWIYQMFAGPPG 55
gi 33576211  10 KRQELNSFLLLAAVMAPVITGIIIVTYGFAVWFYQLLAGPPG 51
gi 499352947 11 KKHERNTFIFLAVFLAPILSVIIVAGFGFAVWISQIFFGPPS 52
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap