Conserved Protein Domain Family
phageshock_pspC

?
TIGR02978: phageshock_pspC 
phage shock protein C
All members of this protein family are the phage shock protein PspC. These proteins contain a PspC domain, as do other members of the larger family of proteins described by pfam04024. The phage shock regulon is restricted to the Proteobacteria and somewhat sparsely distributed there. It is expressed, under positive control of a sigma-54-dependent transcription factor, PspF, which binds and is modulated by PspA. Stresses that induce the psp regulon include phage secretin overexpression, ethanol, heat shock, and protein export defects. [Cellular processes, Adaptations to atypical conditions]
Statistics
?
PSSM-Id: 132023
View PSSM: TIGR02978
Aligned: 19 rows
Threshold Bit Score: 152.019
Threshold Setting Gi: 87199180
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76875882    4 KRELLRDPQRGKIAGVCAGLSDYFNMELWLVRIIFVSAVLLTGGPLFVVAYIAAWFILDKKePTSAYKTNStnygdpleV 83
gi 131424      7 NKKLWRIPQQGMVRGVCAGIANYFDVPVKLVRILVVLSIFFGLALFTLVAYIILSFALDPM-PDNMAFGEQ--------- 76
gi 51589874    7 SKKLYRVPEEGMIKGVCAGLAHYFDIPVRLVRVIMVLSLFFGLFVFTVAAYIILAFMLEPV-SAASVTNDN--------- 76
gi 499406080   7 GKTLYRIPEEGMLKGVCAGLARYFDVPVKLLRIIVVLSMFFGLFFFTIVAYIILTFMLDPA-PAGMGFEDE--------- 76
gi 499967546  13 PKRFYRSRQDKVIAGVCGGIAERFGWEPVLVRILTVLATLFFMGPMAPIIYIVIWMITPRA-PIGYGSMSP--------D 83
gi 499560120   5 RTKFYRDKAHGKILGVCSGLADYAGVDVTLVRVLTVIMTLVGGFPWIVVAYFVTAWLTEDK-PRALQEMDS--------D 75
gi 499718440  11 NRNLYRDPDAGWIAGVCAGLAESYGQPVWLARIIMLSVFIFSGSLGVLL-YIAGVVLLAKR-PRNSYAPSH--------- 79
gi 499459341   6 RRKLYRIPEKGKIKGVCAGLAYYFDVPVRLIRAIAVLSLFFGLFGFVVVAYIVLVFVLDPA-PSEYTEEAH--------F 76
gi 499732911   5 RTTLYRDKQNAKLMGVCSGIADYTGVNPLWVRLGFLV-LLFTIAPILLPAYFIAGLLLNKK-PPHLYVDQD--------- 73
gi 652928575  23 GRTLYR-ARDGKIMGVCKGLAEYFEVEPVWIRLFTILGALATGIWPALGIYILAGLLMKPK-PVMPVRDIH--------E 92
                         90       100       110       120       130
                 ....*....|....*....|....*....|....*....|....*....|.
gi 76875882   84 KFKVWQKGEP-PRRALQDLKERLTRVDTRLQNIERYVTSTEFTVSREINKL 133
gi 131424     77 --------LPsSSELLDEVDRELAASETRLREMERYVTSDTFTLRSRFRQL 119
gi 51589874   77 -----DV--T-PRQLLDQLQHELAQGEQQLRQVERYVTSDTFGVRSRFRQL 119
gi 499406080  77 -----KAART-PSQLLDEADATLQASEQRLRNIERYVTSDTFGVQNRFRHL 121
gi 499967546  84 EDAFWRGVQDrPRATFGTIKYTFMDLDERLKNIERTVTSDEWRLRQEFRDL 134
gi 499560120  76 ETRFWQEVRTkPTVSLRNVKNRFRDINGRLAKVETYITSQDRRLAKEIDNL 126
gi 499718440  80 GRPLFDYGES-ASDRARQLKERMRALEMRLQSMERYVTSNRFNVNKEFKNL 129
gi 499459341  77 ---------S-AQNLLNEIDYQLKSGEIRLRQMERYITSETFSVRSRFRQL 117
gi 499732911  74 ESKYWQRMRQnPKRTVREVRGKFRDIDRRLAEVETFYVSSNPRLNSEIERL 124
gi 652928575  93 GEFYSSYVSS-RKAALARLKEQFARLDRRIRRMEDAVTSRDFDWQRRFDDr 142
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap