Conserved Protein Domain Family
phageshock_pspD

?
TIGR02979: phageshock_pspD 
phage shock protein PspD
Members of this family are phage shock protein PspD, found in a minority of bacteria that carry the defining genes of the phage shock regulon (pspA, pspB, pspC, and pspF). It is found in Escherichia coli, Yersinia pestis, and closely related species, where it is part of the phage shock operon. It is known to be expressed but its function is unknown. [Cellular processes, Adaptations to atypical conditions]
Statistics
?
PSSM-Id: 132024
View PSSM: TIGR02979
Aligned: 3 rows
Threshold Bit Score: 79.5731
Threshold Setting Gi: 391461108
Created: 8-Oct-2014
Updated: 11-Oct-2014
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60
                ....*....|....*....|....*....|....*....|....*....|....*....|.
gi 488316882  9 RAGVILTKliKIMFTAALMYGPAGAASVIMKSVSYKPLRWLLLIILEPMLKRAMAAVASQF 69
gi 353617619 25 KPGFKIAG--KLVLLTALRYGPAGVAGWAVKSVARRPLKMLLAFALEPVLRKAANKISQRY 83
gi 485826560 13 KPGFKLAG--KLVLLTALRYGPAGVAGWAIKSVARRPLKMLLAVALEPLLSRAANKLARRY 71
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap