Conserved Protein Domain Family
ectoine_eutA

?
TIGR02990: ectoine_eutA 
ectoine utilization protein EutA
Members of this protein family are EutA, a predicted arylmalonate decarboxylase found in a conserved ectoine utilization operon of species that include Sinorhizobium meliloti 1021 (where it is known to be induced by ectoine), Mesorhizobium loti and Silicibacter pomeroyi. It is missing from two other species with the other ectoine transport and utilization genes: Pseudomonas putida and Agrobacterium tumefaciens.
Statistics
?
PSSM-Id: 132035
View PSSM: TIGR02990
Aligned: 3 rows
Threshold Bit Score: 410.877
Threshold Setting Gi: 16264165
Created: 8-Oct-2014
Updated: 11-Oct-2014
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 499358580  16 LDDRPVRKRIALVALATDHTSERDFARICDPDQVGVYTNRIAFENPTNKETLLKTGPRLTEAAARILPGEEVDVVAYCCT 95
gi 499217066  16 LDDRPLDKRVGLIILATDHTSEPDFRRMVASERIGVHVARIPYANPTTPENLRKMQPALTAGAALILPDEKLDAICYSCT 95
gi 505056265  16 LDDRPLDKRIGLVILATDHTTEVDFQRMVASDRIGVYVTRIPYANPVTPENLRAMQPSLTEAAALILPDETLDVVMYSCT 95
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 499358580  96 AASIVLGNDTVTRHLNAAKPGTPCVTPSSAAFDAFAALGVRRVSLLTPYSPDVTDEMAQYFAVHGPEVVNAACFGLTDDR 175
gi 499217066  96 SASVVIGDAEIETAIQAAKPGVPVVTPPMAGVRGLNAFGVRRISILTPYTVETSRPMAAYFAARGFEIASFTCLGFEDDR 175
gi 505056265  96 SASVVIGDREVAAAIKAAKPEAAVVTPTAASVQGLRALSANRISVLTPYTIETSRPMADYFAERGFAIDRFTCLGLTDDR 175
                        170       180       190       200       210       220       230
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 499358580 176 EMARISEDCIIEAALAAFDKDAEALFLSCTALRAATCAQRIEDRLGKPVVTSNQAMIWRCLRLAGIPDMVPGYGRLFHL 254
gi 499217066 176 EMARIPPAALVDLARQVTDPQADALFVSCTALRGALAVTGMEQAIGRPVVTSNQATAWNCLRLCGDETPRPEFGQLMTL 254
gi 505056265 176 EMARISPKEIVAFAKEAAAPASDALFISCTAVRAAGVIAEIEQAIGKPVVSSNYATAWACLRLCGDREARPQLGRLMEL 254
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap