Conserved Protein Domain Family
ectoine_eutB

?
TIGR02991: ectoine_eutB 
ectoine utilization protein EutB
Members of this protein family are EutB, a predicted arylmalonate decarboxylase found in a conserved ectoine utilization operon of species that include Sinorhizobium meliloti 1021 (where it is known to be induced by ectoine), Mesorhizobium loti, Silicibacter pomeroyi, Agrobacterium tumefaciens, and Pseudomonas putida. Members of this family resemble threonine dehydratases.
Statistics
?
PSSM-Id: 132036
View PSSM: TIGR02991
Aligned: 4 rows
Threshold Bit Score: 483.586
Threshold Setting Gi: 16264166
Created: 8-Oct-2014
Updated: 11-Oct-2014
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 499282240   7 VTIDDIEVAARRISGRVLTTPLAMSGSLSELCGVPVGLKLEHHQTTGSFKLRGATNAVLSLSAGDRALGVIAASTGNHGR 86
gi 499217067  28 VSLNDIRAARERIASKVEYTPTVLSSSLSERLGVPVHLKLEHRQTTGSFKLRGATNAVSSLSAEEKAGGVVAASTGNHGR 107
gi 499358579   5 ITLQDSIRARARIAGRIRETPLVESPSLSSLSGRQVLLKLESRQITGSFKLRGATNAVLSLTDTQRAAGVVGVSTGNHGR 84
gi 666384393  20 VSLAAIERAATRLSGQVERTPLVRSEFLSERCGHPVHLKLETLQPIGAFKLRGAMNAILSLDDAVRRRGLVTASTGNHGR 99
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 499282240  87 ALAHAAKAEGSVATICMSHLVPVNKVSEIRRLGANVRIVGNSQDEAQEEVERLVAENGLVMVPPFDHRAIVAGQGTLGLE 166
gi 499217067 108 ALAHAAKLEGMRAVICMSRLVPQNKLDEIRRLGAEVHIVGNSQDDAQQEVERLVAQQGLVMLPPFDNPAIIAGQGTLGLE 187
gi 499358579  85 GLAYAAAEAEVRCIICMSELVPQNKVDGIRSHGAEVRILGRSQDDAQQEVDRLVRD-GMTMLPPFDHPDIIAGQGTVALE 163
gi 666384393 100 AVAYAAAKLGIPATICMSALVPANKVEAIRMLGAEIRIVGRSQDDAQEEVERLTKNRGLTAIPPFDHADVVAGQGTIGLE 179
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 499282240 167 VVAQMPDVAMVLVPVSGGGLAAGVAAAVKARRPATRVIGLTMERGAAMKASFAAGGPALVDEQPSLADSLGGGIGLDNRV 246
gi 499217067 188 MIEQVPDAALVLVQLSGGGLASGVATAVKGIRPGTEVIGVSMARGAAMKASLDAGRPVLVEELPTLADSLGGGIGLDNRL 267
gi 499358579 164 MLDQAPDLETVLVPLSGGGLISGVGMVLKAANPDIRVIGVSMERGAAMYECLQAGRPVQVAELPTLADSLGGGIGLDNAY 243
gi 666384393 180 VVEDMPELATILVPLSGGGLAGGIAVAVKALKPRARVIGISMERGAAMHASVKAGRPVSVCEEETLADSLGGGIGLANRV 259
                        250       260       270       280       290       300       310
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 499282240 247 TFRMCRELLDDIILLTEAEIAAGMRHAYAEEREIVEGAGAVGISALLAGKIKdIDGPIAVIISGRNVDMDLHLRVMNG 324
gi 499217067 268 TFAMCRDLLDEIILLSEDEIAAGICHAYAQEREIVEGAGAVGIAALLAGKVK-AKGPMVVLLSGRNIDMNAHRRIICG 344
gi 499358579 244 TFEMTKAFVDEVVLVSEAEIAAAIRHAYFEEREVIEGSGSVGIAALLAGKIG-NPGRCVSLVSGQNIAMDLHKRIIDG 320
gi 666384393 260 TFALCKTLLDEIVLVSEDEIATGICHASREEDLRVEGAGAVGFAAILAGKIA-VSGPAAIIVSGGNIDPAVHKTIIDG 336
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap