Conserved Protein Domain Family
ectoine_eutC

?
TIGR02992: ectoine_eutC 
ectoine utilization protein EutC
Members of this protein family are EutA, a predicted arylmalonate decarboxylase found in a conserved ectoine utilization operon of species that include Sinorhizobium meliloti 1021 (where it is known to be induced by ectoine), Mesorhizobium loti, Silicibacter pomeroyi, Agrobacterium tumefaciens, and Pseudomonas putida. This family belongs to the ornithine cyclodeaminase/mu-crystallin family (pfam02423).
Statistics
?
PSSM-Id: 132037
View PSSM: TIGR02992
Aligned: 4 rows
Threshold Bit Score: 527.896
Threshold Setting Gi: 16264167
Created: 8-Oct-2014
Updated: 11-Oct-2014
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 499358578  18 IRILTEAELRDLVPLDLDAVDCVEQGFTTLAGGKVVMPPIMTLGVPDHNGEVCVKTAYVPGIDSFAMKMSPGFFDNPKIG 97
gi 499281072   4 INILTEKDLRAVVKLDLSAIDCVERAFSALATEAVAMPPILRLDIPEFRGEVDVKTAYVPGFDGFAIKVSPGFFDNPKLG 83
gi 499257599   4 VLLLNQREIRECVTLDTDSIDVVENAFASLARGKVVMPSILRLDISEHNGEVDVKTAYLPDLENFAIKVSPGFFNNPGLG 83
gi 499282241   4 MKILTEAELRGIVPLDREAVACVEDAFRALATKAVAMPPILRLDIPEHRGEVDVKTAYVPGLDGFAIKISPGFFDNPKIG 83
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 499358578  98 LPSTTGLMVVFSSRTGILEALLLDNGYLTDVRTAAAGAVAARHLARAEASHVCIIGAGVQARMQLQAMTLVRDIESAAIW 177
gi 499281072  84 LPSLNGLMILFSARTGLVDAMLLDNGYLTDVRTAAAGAVAARHLAREDASVAAIFGAGMQARLQLEALTLARPIRSARIW 163
gi 499257599  84 LPSLNGMMMLLSGRTGLLQALLLDNGYLTAVRTAAAGAVAARWLARQDSEEVALLGAGEQAELQLKALLLVRDIKRVRVW 163
gi 499282241  84 LPSTNGMMVLLSSKTGLVQALLLDNGYLTDVRTAAAGAVAARRLSREDSSVAAVFGAGMQARLQLEALALVRPIREARIW 163
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 499358578 178 ARDVAKAEAAAASLRQDLGIDVTVGTDIAQAVSPADIVITTTPASSPVIRAEWLQPGQLVIAMGSDQEHKGELEPACLTK 257
gi 499281072 164 ARNHDRAEKLASDFAREHGIDVIAMTDPRAALQGADIIVTTTPAETPILLADWLEEGQHLTAMGSDAEHKNEIDPAVFAK 243
gi 499257599 164 ARSSAKAQQLALQLSSLYGLEATAAESVDEAMSSADIAVTCTPSNQPILHRRHLRPGLHITAMGADTEHKNEVAPEVIAA 243
gi 499282241 164 ARDAAKAEAAAIALGGKLGFAVKAETDPRAAITGADIIVTTTPSETPVLKAEWLEPGQHVTAMGSDAEHKNEIDPHAIAR 243
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 499358578 258 ADlYVPDSQAQCALKGELRSAIEAGLIAAGQSFAELGQVTSGQTPGRRSDRELIIADLTGTGVQDTAIATLAGNRADATG 337
gi 499281072 244 AR-YVADRLSQTRILGELHHAIAAGRVAPDQPFPELGAIIAGKAQGRRSNDDITFADLTGTGVQDTAIANLAFTRAKDAG 322
gi 499257599 244 VDhYVADRVSQTATLGELHHAINAGVAQDLRVYAELGQVILGDRVGRLTPTDVTLCDLTGTGVQDTAIANLAFSRAISTG 323
gi 499282241 244 AT-YVADSLKQTRRLGELHHAIAAHLMSAEAEFPELGQVIAGLKPGRTRADEITIADLTGTGIQDTAIATLAFARANAAD 322

                 ....*.
gi 499358578 338 AGATFT 343
gi 499281072 323 SGQIIE 328
gi 499257599 324 KGLLYN 329
gi 499282241 323 AGTTFE 328
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap