Conserved Protein Domain Family
RraA_entero

?
TIGR02998: RraA_entero 
regulator of ribonuclease activity A
This family includes a number of closely related sequences from certain enterobacteria. The E. coli member of this family has been characterized as a regulator of RNase E and its crystal structure has been analyzed. The broader subfamily which includes this equivalog, TIGR01935, was initially classified as a "hypothetical equivalog" with the name "regulator of ribonuclease activity A" based on the same evidence for this model. It now appears that, considering the second group of enterobacterial sequences within TIGR01935, the functional assignment is unsupported. THIS PROTEIN IS _NOT_ MenG, AKA S-adenosylmethionine: 2-demethylmenaquinone methyltransferase (EC 2.1.-.-). See the references characterizing this as a case of transitive annotation error. [Transcription, Degradation of RNA, Regulatory functions, Protein interactions]
Statistics
?
PSSM-Id: 132043
View PSSM: TIGR02998
Aligned: 4 rows
Threshold Bit Score: 273.22
Threshold Setting Gi: 76876560
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76876560   1 MDYSTSDLCDHFADVVDVLEPMFINFGGRHSFGGRIKTVKCFENNELIRELLSQDGTDLVLLIDGGGSTRRALIDIELAE 80
gi 54042301   1 MKYDTSELCDIYQEDVNVVEPLFSNFGGRSSFGGQIITVKCFEDNGLLYDLLEQNGRGRVLLVDGGGSVRRALVDAELAR 80
gi 1170921    1 MFIDTSELCDLYAEQVDVVEPIFSSFGGVSNFYGKVTTVKCFESNGLIAEVLEENGEGRVLVIDGGGAVRRGLIDAELAQ 80
gi 71145407   1 MQYNTSELCDFYADLIDVVDPIFCNYGGRSSFAGKVVTLKCFEHLGLINELVATYGTGKVLVIDGGGSTRRALIDLGIAQ 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76876560  81 LALENNWQGIIVYGAVRHVDEIEELDLGIQAIASIPVAADSQGAGEDGIGVNFAGVSFFDDDFIYADSTGIVLSAEELEL 160
gi 54042301  81 LATQNEWEGLVIYGAVRQVDDLEELDIGIQAIAAIPVGAAGEGIGESDVRVNFGGVTFFSGDHLYADNTGIILSEDPLDI 160
gi 1170921   81 LAVDNGWEGIIVYGAVRQIQQLENLDIGIHALAPIPVSADESSAGESDIPVNFGGVTFFPEDYIYADLTGIILSQEPLDL 160
gi 71145407  81 CAANNGWEGIVCYGSVRDVDALDGVDIGIQALGAIPVGASEQNIGETDMAINFAGVTLLPDDYIYADNTGIILSPEALEI 160

                .
gi 76876560 161 E 161
gi 54042301 161 E 161
gi 1170921  161 E 161
gi 71145407 161 A 161
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap