Conserved Protein Domain Family
ectoine_ehuD

?
TIGR03003: ectoine_ehuD 
ectoine/hydroxyectoine ABC transporter, permease protein EhuD
Members of this family are presumed to act as permease subunits of ectoine ABC transporters. Operons containing this gene also contain the other genes of the ABC transporter and typically are found next to either ectoine utilization or ectoine biosynthesis operons.
Statistics
?
PSSM-Id: 132048
View PSSM: TIGR03003
Aligned: 3 rows
Threshold Bit Score: 297.535
Threshold Setting Gi: 15890240
Created: 8-Oct-2014
Updated: 11-Oct-2014
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 499281067   5 YEWDTTTwityttSILPIILIGLTVTLKAAAAGFAIALVLGLVFALLRRSRVKLISWPTAVVVEFLRDTPLLVQLFFLYY 84
gi 499257594   4 FDWNYAI------QLLPELFRAALNTIGVTLLGFAIAIVLGLFLAIGRRSARIWISWPIGGVIEFIRSTPLLIQVYFLYY 77
gi 489621451   3 WDWEFVR------QIMPTLIEGLKITILATALGSVVAAVIGLVFAILRMTAPTPIARVTSFAVEFIRGTPLLVQLYFIFY 76
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 499281067  85 VLPEFGIVLPAFLTGALALGLQYAAYTSEVYRGGMEAVHHGQWEAATALNLTRMQTYRDIIIPQAIPRIVPAMGNYLVAM 164
gi 499257594  78 VLPNYGVSLTAMQVGVLGIGLHYACYLAEVYRSGLDAVPRGQWEAVTALNMSPSLAYRNIILPQALRPILPPVGNYLVAM 157
gi 489621451  77 VLPDIGIRLPALVAGVIGLGIHYGTYAAEVYRAGIENVPRGQWEAAKATNLTARQTWIHVILPQAIPPMIPALANYLIAM 156
                        170       180       190       200       210
                 ....*....|....*....|....*....|....*....|....*....|....*...
gi 499281067 165 IKETPVLSVVTVLEMMGLANMIGERTFEYLVPLTLVGLIFLLLTIICSAGLSRLQRAL 222
gi 499257594 158 LKDTPVLSAITVVEIMQQAKNIGSETFRYLEPITMVGVFFLALSIVLAYLVRRVEARL 215
gi 489621451 157 FKETPLLSAITVLELMNQAKSIANSNYRYIEPMTLVGVFFLIMSLISVFFLRWLEARY 214
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap