Conserved Protein Domain Family
ectoine_ehuC

?
TIGR03004: ectoine_ehuC 
ectoine/hydroxyectoine ABC transporter, permease protein EhuC
Members of this family are presumed to act as permease subunits of ectoine ABC transporters. Operons containing this gene also contain the other genes of the ABC transporter and typically are found next to either ectoine utilization or ectoine biosynthesis operons. Permease subunits EhuC and EhuD are homologous.
Statistics
?
PSSM-Id: 132049
View PSSM: TIGR03004
Aligned: 3 rows
Threshold Bit Score: 296.76
Threshold Setting Gi: 16264163
Created: 8-Oct-2014
Updated: 11-Oct-2014
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 499257595   2 ADLLPLMLQGAWVTLQITFFGSLLAIVAATLAALGKMSTWRPLRWFCVVYIEIFRGTSLLVQLFWLFFVLPLppFNLELS 81
gi 499281068   4 TAYLPMLWQGAVVTMTITLAALVVGTVLAFFFGILRVEGGPILSTVALCYTEVFRGTSLLVQLFWFYYALPL--IGLSFD 81
gi 489621449   5 SGYIGLILQGAWVTVQLTLMGSALAVVVAFAAGLGRLSRFMAVRALATTYIEFFRGTSIFVQLFWVYFVLPF--AGITLT 82
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 499257595  82 PYTVAIVGLGLHIGAYGAEIMRGAINSVAKGQYEACTALNFRPFTRFRRIILPQALLAAMGPGTNLLIELLKNTSLVSLI 161
gi 499281068  82 PVTTGVMVLAAHAGGYGAEIVRGALSSVSVQQLEAARALNFTRMQTLFRISLPQAVVEMMPAFGNLAIETLKLSSLVSLI 161
gi 489621449  83 PLQAGVLALGLNVGAYGAEVVRGAVKAIGREQREACIALNLTRFQAMRHIVLPQALPLMLPTFGNNAIELLKGTAVVSLI 162
                        170       180       190       200       210
                 ....*....|....*....|....*....|....*....|....*....|....*.
gi 499257595 162 TLADLSFRARQLDQATFETLKVFALALLMYFVMAQAINLAMRRLERHLARGRVQGS 217
gi 499281068 162 SIADLTFAAQSIRNLTLDSTSIYSITLLCYFAMSLILMVIIRVIEHVVRRGNVFPR 217
gi 489621449 163 SLSDMTFQAQVVRAQTGSTLIPFATILLLYFVMAWLISLGMRWLERRVSRGLDGVR 218
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap