Conserved Protein Domain Family
ectoine_ehuA

?
TIGR03005: ectoine_ehuA 
ectoine/hydroxyectoine ABC transporter, ATP-binding protein
Members of this family are the ATP-binding protein of a conserved four gene ABC transporter operon found next to ectoine unilization operons and ectoine biosynthesis operons. Ectoine is a compatible solute that protects enzymes from high osmolarity. It is released by some species in response to hypoosmotic shock, and it is taken up by a number of bacteria as a compatible solute or for consumption. This family shows strong sequence similiarity to a number of amino acid ABC transporter ATP-binding proteins.
Statistics
?
PSSM-Id: 132050
View PSSM: TIGR03005
Aligned: 4 rows
Threshold Bit Score: 428.094
Threshold Setting Gi: 15890241
Created: 8-Oct-2014
Updated: 11-Oct-2014
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 551051063  35 VSFRSVTK-RYGNFTVLDGLELDVSAGEKVAIIG---PSGSGKSTLLRVLMTLEGIDEGSILVEGESLTHMQgRNGKLVP 110
gi 489621445   6 IRIDNIVK-RYGPLTVLDGLSMEVMPGEKLALIG---PSGSGKTTILRILMTLETISDGFIQVDGEQLYHMK-KAGSLVP 80
gi 499217062  20 VRTHHQGRcHFEELRCLQGAGRLVDAGHAARKAGadrPLGSGKTTILRILMTLERIDGGHIQIEGEQLYHME-RNGQLLP 98
gi 493354769  10 IEFSDVTK-RFGILTVLDQFNFSVAKGEKVTLIG---PSGSGKSTVLRILMTLEPFQEGQLKL-ADISYHQPgGKGPF-Q 83
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 551051063 111 ADAKHVRAVRGKIGMVFQGFNLFPHRTALQNVTEAPVHVLGVKPAEARDRAVQLLEMVGLGAKLDHYPSQLSGGQQQRVA 190
gi 489621445  81 ADERHLHKMREKIGMVFQHFNLFPHKCVLDNVTLAPMLTKGMARAQAEKRAMELLDMVGLADKAKSMPAQLSGGQKQRVA 160
gi 499217062  99 ADERHLARMRQKIGMVFQLFNLFPHKSVIDNVTLAPMLTKGMPRAAAEKRAMELLDMVGMADKAKAMPAQLSGGQKQRVA 178
gi 493354769  84 ASEKHLRQIRNHVGMVFQSFNLFPHMTVLRNIVEAPVRVLGIARAEAEARAIELLNMVGLADKKDHFPVQLSGGQQQRVA 163
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 551051063 191 IARALAMRPKVMLFDEVTSALDPELCGEVLNVIRRLGSEHKLTMLMVTHQMGFAREFADRVCFFYKGRIHEQGAPGQLFE 270
gi 489621445 161 IARALALSPKIMLFDEVTSALDPELVEEVLNVMRKLASETDMTMLLVTHEMGFAHDFADRVLFFDRGKIVEEGKPEDIFR 240
gi 499217062 179 IARALALQPKIMLFDEVTSALDPELVEEVLNVLWRLCAETDMTMLLVTHEMGFAHDFADRVLFFDRGKIVEEGKPDEIFR 258
gi 493354769 164 IARSLAMRPRVLLFDEPTSALDPQLVGEVLSVIRDLAHEHDLTMLLVTHEMRFAREVSDRVCFFDKGRICEQGKPDEIFG 243
                        250
                 ....*....|....*.
gi 551051063 271 TPQEERTRSFLSAVRE 286
gi 489621445 241 HPKQERTQTFLRKIIA 256
gi 499217062 259 NPKQERTQGFLKKIIA 274
gi 493354769 244 QPKEERTREFLSSVLR 259
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap