Conserved Protein Domain Family
pepcterm_ATPase

?
TIGR03015: pepcterm_ATPase 
putative secretion ATPase, PEP-CTERM locus subfamily
Members of this protein are marked as probable ATPases by the nucleotide binding P-loop motif GXXGXGKTT, a motif DEAQ similar to the DEAD/H box of helicases, and extensive homology to ATPases of MSHA-type pilus systems and to GspA proteins associated with type II protein secretion systems. [Protein fate, Protein and peptide secretion and trafficking]
Statistics
?
PSSM-Id: 132060
View PSSM: TIGR03015
Aligned: 9 rows
Threshold Bit Score: 471.859
Threshold Setting Gi: 78223233
Created: 8-Oct-2014
Updated: 11-Oct-2014
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 499701079   1 MYTSFYGFKAKPFQLSPDPSFFFGSKGHNRAMAYLEYGLAQAEGFIVVTGEVGAGKTTLVRNLFRQLEPEKIVAAQIVNT 80
gi 499557435   1 MYESYFKLRAKPFQLNPDPAFFYGSRGHRRAMAYLEYGLHQNEGFIVVTGEIGAGKTTLVRSLLERLEPSKVVAANLVST 80
gi 499607402   1 MYEAFYGLTSKPFQLNPDPSFYFGSKQHRRAAAYLEYGLHQNEGFIVITGEVGAGKTTIVRGMLDSLDQDKVIAAHLVST 80
gi 499630064   1 MYEDYYRFSAKPFQLNPDPRFFYGSKGHKRAMAYLDYGLSLGEGFIVITGEVGAGKTTLVRNLFRQLEAHNLVAAQLVST 80
gi 499424885   1 MYLAYYGFAEKPFQLKPDPNFFFPSRGHKRAAAYLEYGLSQEDGFIIITGDVGAGKTTLMRYLFQKLRQERVAAAQLVST 80
gi 499245086   1 MYEAYFNLTTKPFELLPNPDFIFPSKSHKRALMYLDYGISERAGFILLTGDIGTGKTTLIRNMIQLKD-ERTIISRIFNT 79
gi 490647929   1 MYEEFFGFTTKPFELVPDPEFLYLSRVHKKAITYLEYGIRERNGFLLITGEIGSGKTTIIRNILKSLD-EQVTLSKIFNT 79
gi 499686160   1 MYNEFFHLRTKPFELLPDPDFLYPSKAHRKALAYFEYGLSERSGFILLTGEVGSGKTTLIREMLKR-DLGRMVLSKVFNT 79
gi 499489979   1 MYTAFFGFRVKPFDLLPNPDFLYPSRAYRKASAYLEYGVRDRAGFILITGEVGAGKTTLIRSLLKRSL-GDVLISKVFNT 79
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 499701079  81 SLDSDDTLRMVAAAFGLPLAQgnPGKTPVLVALEKFFRQCEQQGKRALLVVDEAQNLSPQTVEELRMLSNFQGDNKSLLQ 160
gi 499557435  81 QVDQNDILRMVAVAFGVPSRG--LDKAGLLLALETYFVSLAAAGKRALLIVDEAQNLYEEAVEELRMLSNFQLEDHALLQ 158
gi 499607402  81 QLDADDTLRLVGAAFGLRTKD--VSKADVLMTLEAFLISMTGKGKRCLLVVDEAQNLTQRAVEELRMLSNFQFGNHALLQ 158
gi 499630064  81 QLDAEDTLRSVAASFGLEHEG--LTKSALLKNLESFLAAAARQGKRALLVVDEAQNLTPRAVEELRMLSNFQNDERSLIQ 158
gi 499424885  81 RLDPDDALRMVAAAFGLSYEG--LSKAALLLELERFMRKCERESTRVLLVVDEAQNLLPQTLEELRMLSNFQSDNRPLLQ 158
gi 499245086  80 RVEPEQLLAMICHDFGIPAEG--RGKVALLNELNDYLIEQFALGNRPVLIIDEAQNLSADLLEDIRLLSNLETSDTKLLQ 157
gi 490647929  80 KVTSEQLLAMINDDFGLDVAG--KDKIALLRQLNEFLVDEFVAGRQPVILIDEAQNLDIDLLEEVRLLSNLETDKSKLVQ 157
gi 499686160  80 RVDSTQLVAMINDDFGLETAG--RDKMVMLRDLNDFLIDQYAAGRRAVLVIDEAQNLSQELLEEVRMLSNLETDSAKLLQ 157
gi 499489979  80 SVDAEQLVAMINDDFGLETDG--RDKVAMLRDLNTFLIEQYAERRRPVLIIDEAQNLTPEVLEEVRMLSNLETDNAKLLQ 157
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 499701079 161 TFLLGQPEFRKTLLGNDMQQLRQRITATYHLGPMDRAETKSYIEHRLKTVGWGGNPGFDEEAFDAIHQYTGGIPRRINAL 240
gi 499557435 159 SFLVGQPEFREVMQSPQMQQLRQRVIASYHLGPMDAEETRAYIEHRLHHVGWENDPVFAPAAFDAIYGYTGGIPRRINAL 238
gi 499607402 159 SFLVGQPEFRHILQSPNLMQFRQRVIAACHIGPLDVDETKSYIDHRLKCAGANDSIVISPDAHEAIFKASSGIPRRINSV 238
gi 499630064 159 TFLLGQPEFRGILQSPDMQQLRQRVVASYHLGPLDADETRGYIEHRLRTVGWQGMPGFDDDAFAALHRFSGGIPRRLNTT 238
gi 499424885 159 TFLLGQPEFRRTLLGSQMQQLRQRVIATYHLGPLDQAETRAYIEHRLQKAGWNGSPVLQDEIFEVIHNFSAGIPRKINLF 238
gi 499245086 158 IVLVGQPELREVLALPQLLQLRQRISINCHISPLSREETEGYIFHRLDRAGNRNAVAFSSDALDIVYRYSRGIPRLVNII 237
gi 490647929 158 IILVGQPELRRTLANDRLRQLRQRICISCHIDHLSKAEVEEYIFHRLEKAGNRTAVEFGEGAIDLIYLFSRGVPRLINII 237
gi 499686160 158 IILVGQPELRDLLRSPALVQLRQRIQVHCHIAPLSQEELREYVLFRLERAGNRDAMEWGEGVFGLMHEATRGIPRLVNIL 237
gi 499489979 158 IILVGQPELRERIRSPQLLQLRQRILVQCHLEPLTREEVEEYVLYRLERAGNRDALHWEEGVMAEMHRATRGIPRLVNIL 237
                        250       260       270
                 ....*....|....*....|....*....|.
gi 499701079 241 CDRLLLMGYLEKLQHFGVSEVNEVIRDIQQE 271
gi 499557435 239 CDRLMLSAFLAERHEVSGEDVREIVAELKEE 269
gi 499607402 239 CDRLLLFGFLSNKKEFKAEDVEEVAREIYEE 269
gi 499630064 239 CDRLLLFGFLEEKRHFGEAEVDEVIADLRSE 269
gi 499424885 239 CDRLLIMGCLEELQTLGKAEANEVMLDIQKE 269
gi 499245086 238 CDFILLSAFAEQTTEIPGEMVRDIIGDLDFE 268
gi 490647929 238 CDFLLLSAFVEEKKVICTDLVKEVIGEIESE 268
gi 499686160 238 CDYVLLDAYAAGRRSINSAELQDLLAELDFE 268
gi 499489979 238 GSYVLLDAYAAGRRSISLPEMLDLLHSMDFD 268
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap