Conserved Protein Domain Family
EpsF

?
TIGR03017: EpsF 
chain length determinant protein EpsF
Sequences in this family of proteins are members of the chain length determinant family (pfam02706) which includes the wzc protein from E.coli. This family of proteins are homologous to the EpsF protein of the methanolan biosynthesis operon of Methylobacillus species strain 12S. The distribution of this protein appears to be restricted to a subset of exopolysaccharide operons containing a syntenic grouping of genes including a variant of the EpsH exosortase protein. Exosortase has been proposed to be involved in the targetting and processing of proteins containing the PEP-CTERM domain to the exopolysaccharide layer.
Statistics
?
PSSM-Id: 132062
View PSSM: TIGR03017
Aligned: 5 rows
Threshold Bit Score: 667.669
Threshold Setting Gi: 74317812
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 123254142   1 MSFIRFISIIKARYKIIIFTLFITVLTTAIVTILLPKNYKATASVLVNYKGADPVTGVMLPAQLMPGYMATQVDIISSKN 80
gi 27597142    1 MNLNQIVLILLARYRIVLITFALTVFTVLVISLLQSKVYQATASVVLNYKGTDPVTGAVVPGNMALGYVPTQIDIINSQH 80
gi 499716509   1 MTLKHVLLVLWARRWVVLSVLLATITTTAVVSLLIPKEYTASTTVVLDVQTPDRIVGMVLPGMMSPGYMATQMDIITSDR 80
gi 499698871   1 MTLQQFLLILRARYKVVLYILLFTVIATLVVSLLLPKQYTAGTAVVVDIKSPDPVAGMVLPGLTSPTYMATQVDVINSDR 80
gi 499631572   1 MNFTQLLLVLYARKWIVLGVLLVAVTATAVVSFLLPKEYSATTMVVIDSKSKDPVTGQLMPSQMFPGYMATQVEIIQSAR 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 123254142  81 VAKKVIDKLGLADVPAVKEDFYQATSGKGEIKEWLADLLLKKLQVKPSRESSIIDISFFGVNPQFAATIANEFAESYMQT 160
gi 27597142   81 VALKVVDELRMAENENVKAKFEEDTGGRGDLRFWLADLLLKKLTVTPGRDSSVIEIMFEGSDPDFVALVANAFANAYQET 160
gi 499716509  81 VAQGVVRLLKLDENPETREKWLEETGGQGSLAVWLAPGLKKNLEVSPARESNVISVEFSATDPRFAATAANAFAQAYIDT 160
gi 499698871  81 VAERVVKMLRLDESPVVKEQWEED-GSKGELTTWLANLLKRKLDVKPSRESNVIYIEYTGNDPNFAAAVANAFAQAYIDV 159
gi 499631572  81 VARNVVRALKLDESPAIRQQFMDATQGQGSIEQWLGDLLLEKLEVEPSRESSAISIEYSGADPRFAAIVANAFAKAYIDT 160
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 123254142 161 SIQLKVEPSQKAALYFVEQLKELREDLAQAQSKLSEYQQEKGIVSVDERLDVERARLNELSSQLVIAQAQVMEARSREKN 240
gi 27597142  161 NVEMKVEPAQKAAEYFGTQIQALRDNLSKAQSRLSKYQRENGYTSSDERMDVEASRLNWLSEQLVAAQGQSIEADSRSGG 240
gi 499716509 161 TIDLRAEPARKYAAWFEQQYETQRERLQRAQKALSDFQQQTGIVVTNDRLDFENQKLGELTAQLSLALAEGTDSSSKQGF 240
gi 499698871 160 NLDLKVAPARQYAHWFKGQTAAARDELERAKAALSAYQQETGLVATEERLDYEVAKLNELSSQLTLIQAQTSDSSSKRKA 239
gi 499631572 161 NLELRVAPAKEATTWYDQQIAQLRAKLDEAQQKLTAYQREKGLVESDQRLDVETARMAELAAQMVAAQSAAFDASSKVRG 240
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 123254142 241 SSGkEAYesPDVAANPIIQNLKTEIARAESRFADVSQKFERNHPFYLGAKAEIENLKSELDRQIKSVSSNVASNSRILQQ 320
gi 27597142  241 SRK-NALesPDVVSNPIIQNLKINLATAESKLAELSQRLDKNHPQYQAAEAEINKIKSQLNAEVKTVTGSVGNGAGIQKQ 319
gi 499716509 241 HQGgDTL--PEIMRNPLIIQLKTDIARLESRLQELSEDYGVNHPQYKSAASELASMKSRLRMETAKIAESISTVGRVSKA 318
gi 499698871 240 AEDpDTL--AEVIQSPLINSLKSDIARLDAKLQESSAYLGPNHPQTKRTQSELASLRGKLSAETRKIHSSIGTSYEVGKR 317
gi 499631572 241 SGD---L--PEVINNPVVQSLKGKVAATEGKLAELARRVGPNHPEYVRLQAEANSYRSQLNEEIARATRAVEATSGAAKQ 315
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 123254142 321 REAEIRLALNNQKEKVLQLNRDRDILSVLTREVENAQKAYDMAMQRYTQTNIEGQSNQSDISLLNPAVAPLTPTSPNLLL 400
gi 27597142  320 RVAELQAQVDKQKAVLVEMNRTRDEMLVLQKDVEMAQRAIEGAMLRFSQTSIESKSNQSDVAILNTATSPLLPSGTRTLL 399
gi 499716509 319 KQAELKEAIEEQKKKMLELKSQHDQIQILSHQVETAQRDFDAISQRLTQSQLEAQTVQTNVSVLTPASPPLRHSKPILFL 398
gi 499698871 318 KEQELLEAMERQKGRVLELNRQRDQMSVLQGDVEAAQRNFEGISQRSALTRLESLSVQTNITPLNPASVPSEPSSPKLLL 397
gi 499631572 316 RLGGISGAFEAQKARVLDLKKQREEATLLARDVESAQRVYDAALQRYSQTRMEAESTQTDIGILNPAVPPLEPSSPRIVL 395
                        410       420       430       440
                 ....*....|....*....|....*....|....*....|....*.
gi 123254142 401 NIILSILLGMFLGIGFGVLAEFVDRRVRTADDLIEVLQAPLLGTIS 446
gi 27597142  400 KLALGAIIGMLLGIGFAFVSEFMDRRVRSKDDISAILDVPVFALID 445
gi 499716509 399 NLVIAVMLGGLLSVGAALILELRNPVVRSIEDLQSALGVPVLAQLG 444
gi 499698871 398 NTLISIFLGTLLGVSAALVMELMNRRVRSVEDIVEAIEIPVLAVMS 443
gi 499631572 396 NIVLSIFLGGLLGMGIGFLVELWDRRVRSAQDIAE-LDIPLLAEVG 440
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap