Conserved Protein Domain Family
pepcterm_femAB

?
TIGR03019: pepcterm_femAB 
FemAB-related protein, PEP-CTERM system-associated
Members of this protein family are found always as part of extended exopolysaccharide biosynthesis loci in bacteria. In nearly every case, these loci contain determinants for the processing of the PEP-CTERM proposed C-terminal protein sorting signal. This family shows remote, local sequence similarity to the FemAB protein family (see pfam02388), whose members [Unknown function, General]
Statistics
?
PSSM-Id: 132064
View PSSM: TIGR03019
Aligned: 11 rows
Threshold Bit Score: 479.542
Threshold Setting Gi: 168705171
Created: 8-Oct-2014
Updated: 11-Oct-2014
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 499710127  12 AAWDLFVE-SCPQGTFFHRAGWQRVIDQAFGQTNHFLYAEQ-DGAIVGVLPLTYVRSPLFGNRLVSTAWCVGGGAAVVEA 89
gi 499701077  33 RRWDDFVS-CCREATFFHRAGWQTVIERAFGHKTWFLYAEC-EGEIQGVLPLAEINSRLFGHSLSSLPFCVYGGIAADSQ 110
gi 499607405  15 ARWDAFVY-ASPEATFFHRADWQGIIREVFKHPTWYLYAEE-NGEIVGVLPLAQINSLLFGNSLTSLPFAVYGGVVASRP 92
gi 488899885  25 NRWDEFVE-AHPEATFFHLAGWREVLERAYGHATHYFYAEQ-DGKIVGLLPLARIRSRLFGDALISTPFCVYGG-AVGSR 101
gi 499557438  17 GRWDAFVR-GCPDATFFHLSAWQGIIREIFRHRTFFLYAER-AGDIIAVLPLAEVNSRLFGHALTSLPFCVYGG-PAGDP 93
gi 499630067  26 ARWDTYVA-AHPGATFFHRAGWKRVIEDAFAHRTHFLLAER-AGEIVGVLPLAEIKSRLFGHSLGSLPFCAYGGILADDD 103
gi 500031559  19 QAWDRFVE-AAAGGSFFHLAGWQRLLSGLYKHPTYYLYGQR-DGQVVGVLPLARVRSRLFGDALISTPFCVYGGVVAQDL 96
gi 499715841 126 ASWDDYVD-QHPQSSPYHKIWVKSFVESVYGHPCRFICALDeTDRIVGVLPLTQLNSRLFGNFIVSAPYFNYGGILADSR 204
gi 500111323  18 ALWDAYVA-AHAESTGYHRMGWTRVAQRAFGHAAYPLAAFD-GGRIAGVLPLVHIRSRLFGRFLVSLPFVNYGGLLADSA 95
gi 497737128  28 ADLAAFVRhSAPEVPLSKHPLWLDVLRSSLGHEVYALEATA-SGRTVGFLPLACVDSVLFGRFLVSLPYLNTNGVIAPTA 106
gi 499424883   1 -------M-ACPEATFFHRAGWKQVIEQAFGHKTWFLYIEE-GGCIQGVLPLAEIDSLLFGHSLSALPFCVYGGIAAISD 71
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 499710127  90 AAAEALERAAVDLLMAGPARYIEIRDPAV-PHgegSGWQCK-EgLYAAFERPIAASDEACLTAIPRKQRAVVRKAIDSGL 167
gi 499701077 111 TVRDALDRSAQKLAQELQVDYLEYRNLKP-HH---ADWHGK-D-LYVTFRKEIASEIEQNMSAIPRKQRAMVRKGIKAGL 184
gi 499607405  93 DVVSMLEQEAQKLAQELKVDHLEFRNLTP-RH---SEWPIQ-D-LYVTFRKEILPDVEANMLAIPRKQRAMVRKGIKNGL 166
gi 488899885 102 EACDALEAAAYRVAWDLGVDYLELRNLQL-RH---SDWPCS-E-LYVTFRKNIDPDPEKNLAAIPRKQRAMVRKGIKAGL 175
gi 499557438  94 EGIALVEAEAETLARRLRVQHLELRNLTP-RH---EEWPRQ-D-LYVTFRKEIQADDDANLLAIPRKQRAMVRKGIRHGL 167
gi 499630067 104 EAARALDAAAQALATRLGVGALEYRNQVA-QH---PDWPTK-D-LYVTFKKAIAPEVEANMNAIPRKQRAMVRKGIKAGL 177
gi 500031559  97 QVQEALLDEARWLTARLNVAHLELRSVTP-LD---DGWINK-P-LYATFRKPIVAEPAANLREIPRKQRAEVRRGIQAGL 170
gi 499715841 205 QVAQILLADAVRWRDQVGAGHIELRHLTP-SS---LRLPQR-T-EKLTFWLALPQQEDDLWLSFKPKVRAQIKRPQKEGA 278
gi 500111323  96 EAAQALIDEAEGLLRRTGAGSIELRHVGP-PR---LGLSAK-S-HKVTMLLDLPDDPDTLWRGLRDKVRNQVRKAGKSGL 169
gi 497737128 107 DVRAELIARAAGLADELNVRHLELRHEAPvAH---PALTASiT-SKVHMRLALPSTPERLWKGFDTKVRNQIRKGEKGGF 182
gi 499424883  72 DARIRLDQAAQMLATYLKVDYLEYRHLHP-FH---HDWPTK-D-LYVTFRKTMDSDVEQNMLAIPRKQRAMVRKGMKYEL 145
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 499710127 168 QGRFDDD--PSTFYELYALSMRNLGTPVFSKPYITLLRDVFGVDTTTIYTVyGDQRPLSSVLNFTFRDKIMPYYTGADPE 245
gi 499701077 185 ESVVDQD--IERFFSAYSASVHRLGTPVFSRKYFRLLKEVFAEDCELMIIV-KDNRTISAVMSFYFRDEVLPYYGGGTGE 261
gi 499607405 167 ISTVDPT--CDRFFSLFADNVHRHGTPALPKRYFDSLLRTFGNDCEILTVTgPDGRILSSVLSFYFRDEVLPYYAGDDEA 244
gi 488899885 176 TSSTDSD--IERFFLIYSESVRNLGTPVFPKRYFEILKTVFGDRCEVLTIF-HEGTPISSVMSFYFRDEVLPYYGGGLAG 252
gi 499557438 168 TSRVEPD--VERFFSLYADNVLRHGTPALPKAFFARLMKDFGPDCEVLTVSdADGNALSSVLSFYFRDEVLPYYAGDAVM 245
gi 499630067 178 VGEIDGD--TRRFFEAYSASVHRLGTPVFSRRFFRLLKDAFGDDCEVLTITl-KGEVIASVISFYFRDEVLPYYGGGTDA 254
gi 500031559 171 VTRLLQN--PDPCYRIYAESLRNLGTPVFARAHFQTLKQIFAERCEVAVVE-QHGVAVSGVLSFYFRDQVLPYYGGALPH 247
gi 499715841 279 EVTIGGAelLDDFYAVFSRNMRDLGTPVYGRNFFYGFLSSYGESARVVIGRlNKTVVACAIVIGHGRRMEIP-WASTLQE 357
gi 500111323 170 TVEQGGAglLGPFYDVFAVNMRDLGTPVYSRRFFETIMDEFPGATRIVAVRdGDAVVAAALCYTHGNTFEVP-WASSLRT 248
gi 497737128 183 AVTWGGAecLDGFYDVLAENMRDLGSPVYGIELFRAILATFPGDAEICLVRsGATPVAAALLLHGWGVTEVP-TASSLRD 261
gi 499424883 146 QSYLDQD--TDHFFRAYSASVHRLGTPVFSRKYFRLLKSVFAEDCELLIIT-KDENVVSAVMSFYFRDEVLPYYGGGTDA 222
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 499710127 246 ARKQGAADLMYYGVMCAARARGLGVFDFGRSKVGTGPFAFKKNWGFTPRPVIHEYLVKDGGPMPDVNPTNPKYRAMIALW 325
gi 499701077 262 AREVAGNDFMYWELMRRACEKGCKVFDFGRSKRGSGSFDFKKNWGFEPQPLHYEYQLHQAKEVPDHNPLNPRYQIFIKAW 341
gi 499607405 245 ARDQAANDFKYWELMRRACERGLKIFDYGRSKVGTGPYAFKKNWGFEPRPLSYEYCLYKGNDIPQNNPSNAKYKLFIAAW 324
gi 488899885 253 AREFKANDFMYWELMRRASEQSVRVFDYGRSKLDAGSYRFKTHWGFKPQPLHYEYKLIKANKVPEKNPLNPRYRLFVEGW 332
gi 499557438 246 ARDVAANDFKYWELMRRAAARGCRLFDFGRSKIGTGPFSFKKNWGFEPQPLSYEYRLYRRDSVPQNNPMNPKYRAFIALW 325
gi 499630067 255 ARAVAGNDFMYWDLMRRACERGLKVFDFGRSKRGTGAFDFKKNWGFEPTPLHYEYFLVADSTVPEINPLNPKYRLFIEAW 334
gi 500031559 248 GRQVGAYPYMYYDLMNRAAAQGCRWFDFGRSKRGTGAYDFKRFYGFSPQPLHYGYYLYERRELPDLNPLNPKYQRFIALW 327
gi 499715841 358 ANSSGINMLMYWEILKFSIHQKYQIFDFGRCTEGSGTYKFKQQWGATPVRLHWDYCLAEGRDAPKLNPDNPKFKLVIAVW 437
gi 500111323 249 HRDRCPNNLMYWHCMETACREGFTVFDFGRSSRDSGPWRFKAQWGAREVPLSWEYLLADGAPLPDLNPSSARFSLAVRVW 328
gi 497737128 262 YNPSNVNMLMYHALLLRSVERGQRVFDFGRSTADGSTFKFKKQWGAVPHPAAWQYAVQRG-EVGEMRPDNPRYRLAIRLW 340
gi 499424883 223 ARDLAGNDFMYWELMRRACERGYRVFDFGRSKRGTGSYSFKKNWGFEPQPLFYEYQLHQAKTIPEHNPLNPKYQLFIKAW 302
                        330       340
                 ....*....|....*....|
gi 499710127 326 RRLPLAVANTLGPWISRQVG 345
gi 499701077 342 QKLPLGLANLVGPHIVRNLG 361
gi 499607405 325 RRLPIGLANLLGPHIVRNLG 344
gi 488899885 333 KRLPMPLTRLVGPWIARDLG 352
gi 499557438 326 RRLPIRVANAIGPHIVRNLG 345
gi 499630067 335 KRMPRALANAIGPHIVKNLG 354
gi 500031559 328 RRLPLAVANGLGPLLARNLG 347
gi 499715841 438 KRLPVWLTNMVGPLLVKYLP 457
gi 500111323 329 RHLPVALTRFIGPHIVRSIP 348
gi 497737128 341 QKLPVELTRAFGPRIVRGIP 360
gi 499424883 303 QKMPLALANMLGPHIVKNLG 322
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap