Conserved Protein Domain Family
pepcterm_export

?
TIGR03027: pepcterm_export 
putative polysaccharide export protein, PEP-CTERM sytem-associated
This protein family belongs to the larger set of polysaccharide biosynthesis/export proteins described by pfam02563. Members of this family are variable in either containing of lacking a 78-residue insert, but appear to fall within a single clade, nevertheless, where the regions in which the gene is found encode components of the PEP-CTERM/EpsH proposed exosortase protein sorting system. [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
Statistics
?
PSSM-Id: 132072
View PSSM: TIGR03027
Aligned: 12 rows
Threshold Bit Score: 221.03
Threshold Setting Gi: 78223237
Created: 8-Oct-2014
Updated: 11-Oct-2014
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 490647925  39 YVVGDGDSLMISVWGEKELSGTVTVRPDGKITLPAIGDVIASGFTPTKLSEDLAEKLAKVVNKPIVTVTVNTvtnnkiyv 118
gi 499424889  41 YLIGPGDTLNIIVWRNPEISMSVPVRPDGKITTPLVEDLPASGKTSTELARNIEETLSKYLQQPVVTVVITG-------- 112
gi 499650090  44 YIIGPGDQVDIFVWGNEELSSSIIVHPDGRLTSPLVEDLQASGKTPTELARDIEKILSRYVRAPIVTVIVNE-------- 115
gi 499701083  44 YLIGPGDNVDIIVWRNPEVSMAVPVRPDGKITTPLVEDLSASGKTSTQLARDIEEALSKYIQQPVVTVVVTE-------- 115
gi 499357047  47 YLIGSGDVLNIFVWRNPEVSGSFVVRPDGMITTSLVEDIEVSGKTPTELARSIEKILATYLRDPIVTVTVEN-------- 118
gi 499630060  43 YLVGPGDSVNVFVWRNPEVSGTFPVRPDGKMTMNLVEDLQASGKTPTQLARDIEKALGKYIQEPIVTVIVGG-------- 114
gi 499557431  48 YVIGPGDSVNIVVWRNPELSMAVPVRPDGKITTPLVEDLPALGKDSSTLARDIEQALAKFIREPVVTVIVTS-------- 119
gi 499607398  44 YKIGPGDNLNIVVWRNPELSMVVPVRPDGKISSPLIDDLNAMGKDSTSLARDIEKELAKYIRDPVVTVIVTG-------- 115
gi 499710131  45 YVVGPGDSLDVFVWGQPDLSRSIVVRPDGRLTLPLVTDLVAAGKTPSELSAAITEQLQTYVQNPVVSVMVVN-------- 116
gi 499715836  47 YILGPGDVVNINVWRNPELSGSVPIRPDGKLSTTLVGDIVASGKTPAQLAEEIKQKLSVYIREPQVSVVVTG-------- 118
gi 499489976  25 YIINHGDGISVNVWGEKELSVKVTVRPDGRITLPGIGDMDAAGQTAEQLQAKITTRYAELVRNPVVTVSVDMsqnnsviv 104
gi 499686157  26 YVIGSGDGLLVNVWGEQELNVAIAVRPDGMITVPGVGEVMAQGKTPQQLTTELSRKLAELVRNPIVTVSVTQvrnnsvtv 105
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 490647925 119 fgggvpsgvavlpsrttllqflirygnfkgidlgnayllrngkkmdvdfhsllvkgdvakdvplkpedmiYIPdNEAYKI 198
gi 499424889 113 ----------------------------------------------------------------------FVG-PFSEQI 121
gi 499650090 116 ----------------------------------------------------------------------FIG-RFSEQV 124
gi 499701083 116 ----------------------------------------------------------------------FVG-PYSEQI 124
gi 499357047 119 ----------------------------------------------------------------------FVG-PFSEQI 127
gi 499630060 115 ----------------------------------------------------------------------GIG-PFDQQI 123
gi 499557431 120 ----------------------------------------------------------------------FVG-PYSEQI 128
gi 499607398 116 ----------------------------------------------------------------------FVG-PYSEQI 124
gi 499710131 117 ----------------------------------------------------------------------FAG-PFDKQV 125
gi 499715836 119 ----------------------------------------------------------------------MQSyEFSSRV 128
gi 499489976 105 hgpgvkpgmvpmagrttllqlltriapeatadldgatltregtvlrtgfrdlyergaiaddvelkpgdrvFIPfRAKWSV 184
gi 499686157 106 hgagvqaavvplersttllellaqlspgdtadfdnaylsrqgrrivsgftglfvkgetendvalqpgdriFIPyRADRNV 185
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 490647925 199 YVMGAVANPKYVFYRDGLRILDAIIETGGFTKFAKENDVLIVRKEGTSTTEISAKVKDLMKEGDMTQNVHLKPGDFVIVK 278
gi 499424889 122 RVIGEAAQPQALPYRENMSLMDVMIAVGGLTDFAAGNRARIIRNVDGEQQQFRVRLEDLIRDGDISANVPVYQGDVLVIP 201
gi 499650090 125 RVVGEAADPSALSYQEHMSLLDVMIEVGGLTEFAAGNSATLVRTANGREKQFSVRLDDLIRDGDITANVEILPGDILIIP 204
gi 499701083 125 RVIGEAAEPQALPYREEMTLMDVLIAVGGMTDFAAGNRARIVRNVDGKQHQFSVRLDDLIRDGDVTANVPMKQGDVLVIP 204
gi 499357047 128 RVIGEAAQPRAINYTQHMTLLDVMIQVGGLTEFADGNDAVLIRIESGTQNQYQVMIDQLLKDGEISANVDMLPGDIIIIP 207
gi 499630060 124 RVVGEAAKPQALNYREKMSLVDLMIAVGGLTDFAAGNKAYILRTVDGKQERLGVRLEDLLRGGDVSANVDMRPGDVLVVP 203
gi 499557431 129 RVVGEAATPQVLPYVQKMTLLDVMIAVGGVTEFADGNGASILRTGEGN-KQYSVRVKDLLKRGDVSANVEMRPGDVLIIP 207
gi 499607398 125 RVIGAATKPQILAYKQKMTLLDVMIAVGGITDFADGNGATILRTSENNA-QYSVRIKDLVKRGDVSANVEMKPGDVLIIP 203
gi 499710131 126 RVVGEAATPKALQYRDRMTTLDAMIEVGGLKQFAAGNRAVLVRGQPPEAKSYRVRLEDLMNDGDITANVPLMPGDVLIIP 205
gi 499715836 129 RVTGAVKSPISIPYRHGMTVMDVVLTAGGLNDFANGDSSVLYRQYQGKSVIIPVKLNEIFQEGDVTTNYELNPGDIITVP 208
gi 499489976 185 YVVGAVNEPMTLTYHEGMTLMEALLAAKGFTRFADRNKTEVVRERDGRQEVVVVRAGDLIDKGDLTQNVPLQAGDYVIAK 264
gi 499686157 186 FVMGAVNNPMAIPHHDGLSVLEALLEAGSFNKFADRNNTVIVRHDGVEKKSIAVRGGDLVNDGDLTQNLELQPGDYVIVK 265

                 ....
gi 490647925 279 ESIF 282
gi 499424889 202 ESFF 205
gi 499650090 205 EAWF 208
gi 499701083 205 ESYF 208
gi 499357047 208 EAWF 211
gi 499630060 204 ESLF 207
gi 499557431 208 QSWF 211
gi 499607398 204 QSWF 207
gi 499710131 206 QSWF 209
gi 499715836 209 EKVL 212
gi 499489976 265 KGLF 268
gi 499686157 266 KSFF 269
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap