Conserved Protein Domain Family
EpsE

?
TIGR03028: EpsE 
polysaccharide export protein EpsE
Sequences in this family of proteins are members of a polysaccharide export protein family (pfam02563) which includes the wza protein from E.coli. This family of proteins are homologous to the EpsE protein of the methanolan biosynthesis operon of Methylobacillus species strain 12S. The distribution of this protein appears to be restricted to a subset of exopolysaccharide operons containing a syntenic grouping of genes including a variant of the EpsH exosortase protein. Exosortase has been proposed to be involved in the targetting and processing of proteins containing the PEP-CTERM domain to the exopolysaccharide layer.
Statistics
?
PSSM-Id: 132073
View PSSM: TIGR03028
Aligned: 4 rows
Threshold Bit Score: 432.684
Threshold Setting Gi: 74317813
Created: 8-Oct-2014
Updated: 11-Oct-2014
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 499716510  40 NYRLAPGDAIRINVFQQPDLTLDTRISENGSITYPLIGSLQLGGETLAAAEQQIAAGLRQGKYVKDPQVTITLLEIRGNQ 119
gi 499698870  26 DYPLGPGDILRIQVFQNPDLTTETRVSESGSITFPLVGALEVGGLSVASAENKLAAALKKGGFIKQPQVTIVLLQMRGSQ 105
gi 499799513  32 DIVLGPGDVLRISVFEQPDLSLEVRVSESGTITYPLIGEVRVGGETPAAAERKIASMLESGGFLKNPHVNIIVAQLQSQQ 111
gi 499631573  26 DYRMGVGDVVRITVYGQPDLTTDARVSAKGNISFPLIGEVKLAGTTPAEGEREIASRLSKGGFVVQPFVTLNVVQYRGQQ 105
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 499716510 120 VSVLGQVSRPGRFPLDTQkTRLSDVLAMAGGVTASGSDIVVVSGIREGRPFHKEVDFPSIFSQGERNENILVAGGDVIFV 199
gi 499698870 106 VSVLGQVNRPGRFPLETL-SRVSDMLAAAGGTTPLGDDFAIVTGTRNGQAFRKVIDIPALYLEERSDEDIILAGGDTIYV 184
gi 499799513 112 VSVLGQVNRPGRYPLDSA-KSLADVLALAGGVAPDGGDLISLVRKIEGKSVREIIDFAEMMRDGDLNKNILLTAGDIIYV 190
gi 499631573 106 VSVLGRVNRPGKYPLEKA-GRVSDALALAGGILPDGADVITLVRERDGKIEYRQIDVLALFNPGGDPNNVVVQDGDIINV 184
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 499716510 200 DKAPVYYIYGEVQRPGVYRVERNMTVQQALAQGGGISLRGTDNGIKVYRKDAKGDVELKESELYDPVRADDVIYIRESLF 279
gi 499698870 185 HRAPVFYIYGEAQRPGAYRIERGMTVMQALAQGGGPTPRGSEWWLRLHRRNADGVVEKLSPDMTDAVQPNDIIYVRESIF 264
gi 499799513 191 DRAPRFYIYGEVQRPGQYRLEYHMTVLQALAVGGGLSLRGTEKGIKVKRLDDEGGVKIIKVKHDDFIQPNDVVYVQESVF 270
gi 499631573 185 ARQPMFYIYGEVQRPGAFRLEQNMTLMQALSMGGGLTPRGTQRGIRIMRRDDKGAVREVSGELGDLVKPDDVIYVKESLF 264
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap