Conserved Protein Domain Family
EpsG

?
TIGR03029: EpsG 
chain length determinant protein tyrosine kinase EpsG
The proteins in this family are homologs of the EpsG protein found in Methylobacillus strain 12S and are generally found in operons with other Eps homologs. The protein is believed to function as the protein tyrosine kinase component of the chain length regulator (along with the transmembrane component EpsF).
Statistics
?
PSSM-Id: 132074
View PSSM: TIGR03029
Aligned: 3 rows
Threshold Bit Score: 452.78
Threshold Setting Gi: 53802562
Created: 8-Oct-2014
Updated: 11-Oct-2014
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27597143   19 NDANIGKVLLDLGKLTPDEAERVLRLQKQENIRFGEAALRLGFINESDIRQALSVQFEYPYLQPNEGGFSPDLVAAYQPF 98
gi 499698872  33 NSSSIGAILVNAGRLSEENVTRILEAQVQQQNHFGEAAICLGLLTEDDVRFALSRQFNNLYLPAGDSSLSHHLIAAYKPF 112
gi 499261979  15 SDVQLGQLLLHAGKLSEKDIEAIGVKQKEDGLRFGEAALRLGLIGEDDLRQALARQFAHPCLPESDTSVDAELIAAFCPP 94
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27597143   99 SKQVEALRALRTQLILRWF--SEGNKALAVVAAKSGDGCSYIAANLAIVFSQLGEKTLLIDGNLRDPVQHRNFNLSEQRG 176
gi 499698872 113 SPVVEHLRSLRSQLMLRWFepDTDRNVLAIVSPGLGEGRSFIAANLAIVFSQLGKSTLLIDANLRAPRQQEFFKVNTGGG 192
gi 499261979  95 GPEGEALRDLRSILMLRWF--GGHRRLLALTSGRPGEGCGRLAANLAVVFSQLGERILLIDANLREPELHRLFKLCGDPG 172
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27597143  177 LSDILIGR-SDLEVITHLGAFENLSVLGAGTIPPNPQELLARPAFTDLMNKVMGDYDVIIVDTSSTEHSSDAQSVASRCR 255
gi 499698872 193 LSSYLAGR-AGLESIVRIPSLLGLSVLPAGAVPPNPQELIGRPVFADLLQSVGCEFDVVIVDTPSASEYGEAQIIATEAS 271
gi 499261979 173 LSGVLAGRhSPEKAISSIPALGDLSVLPAGAPPPNPQELLSRASFIRLLDAAAEQYDIVLLNTPPALQSADARIVATRAA 252
                        250       260       270
                 ....*....|....*....|....*....|....*..
gi 27597143  256 GTLAISRVNETRMHELTSLKEHLSGVGVRIVGAVANQ 292
gi 499698872 272 AALIVLRKNHTSLSRTVDLARRFQQTGAAVVGSVLND 308
gi 499261979 253 GCIIVVRRDATRLGDAAALRDQLSGAGVEVLGAVLTS 289
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap