4CZ1,4COB


Conserved Protein Domain Family
trp_arylform

?
TIGR03035: trp_arylform 
Click on image for an interactive view with Cn3D
arylformamidase
One of several pathways of tryptophan degradation is as follows: tryptophan 2,3-dioxygenase (1.13.11.11) uses 02 to convert Trp to L-formylkynurenine. Arylformamidase (3.5.1.9) hydrolyzes the product to L-kynurenine and formate. Kynureninase (3.7.1.3) hydrolyzes L-kynurenine to anthranilate plus alanine. Members of the seed alignment for this model are bacterial predicted metal-dependent hydrolases. All are supported as arylformamidase (3.5.1.9) by an operon structure in which kynureninase and/or tryptophan 2,3-dioxygenase genes are adjacent. The members from Bacillus cereus, Pseudomonas aeruginosa and Ralstonia metallidurans were characterized. An example from Pseudomonas fluorescens is given the gene symbol qbsH instead of kynB because of its role in quinolobactin biosynthesis, which begins with tryptophan. All members of this family should be arylformamidase (3.5.1.9). [Energy metabolism, Amino acids and amines]
Statistics
?
PSSM-Id: 132080
View PSSM: TIGR03035
Aligned: 9 rows
Threshold Bit Score: 359.809
Threshold Setting Gi: 33592362
Created: 8-Oct-2014
Updated: 11-Oct-2014
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4CZ1_A         5 KWIDISQPLNNDIATWPGDTPFSYEVLWSKEESGSVNVGKLTMSIHTGTHIDAPFHFDNDGKKVLDLDIQVYVGPTRIID 84
gi 489205815   5 RYWDISPALDPNTPTWPGDTPFQQEWAARLDEQCPVNVGRITLSPHTGAHVDGPLHYRADGLPIGQVPLDIYMGPCRVIH 84
gi 499371538   6 RWWDISPPLSTATPTWPGDTPFQEERVWQFGPECPVNVGRVTLSPHTGAHVDAPLHYRPDGLPIGEVSLDVYMGPCRVLH 85
gi 499309939   4 TLWDISPALSTATPTWPGDTPFSQEIAWKLEGDCPVNVGRITLSPHTGAHADAPLHYHADGAPIGAVPLDAYLGPCRVIH 83
gi 499564724   9 RWIDVSQPLNEKLAHWPGDLPYSYQLTFSKQQTGSVNIGQMAMSVHSGTHVDAPFHFKNDGAKITDLDIHVFIGKARVVD 88
gi 499377585   3 VWIDISQPINNNLACWPGDQSFHFHTPVTKEMTGSVNIGRITTSTHVGTHADAPYHFMEDGKRILDLEIDRYIGPCKVID 82
gi 490669243  32 TIWDISPPIAPATPVWPGDTPVGIERVWRIEAGSPVNVARVTLSPHTGAHADAPLHYDADGAPIGAVPLDAYLGRCRVIH 111
gi 489907096   3 RLWDISPPVSADSPVFPGDTPYRQQWKWSLTPDCPVNVSEITLSPHIGAHADAPLHYENGAAAIGAVALEPFLGPCRVIH 82
4COB_A         7 RYWDISPALDPNTPTWPGDTPFQQEWAARLDEQCPVNVGRITLSPHTGAHVDGPLHYRADGLPIGQVPLDVYMGPCRVIH 86
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4CZ1_A        85 -VSNLESIGKKELEKFHLEGVERLLLRTSSHGKANeFPDIIPHLRADIAPFLSEKGIRLIGVDVPSVDPLDDKELAAHHQ 163
gi 489205815  85 cIGANPLVTPEHLAGQLDDLPSRVLLRTFERVPAN-WPEGFCAIAPATIECLAERGVRLVGIDTPSLDPQHSKTLDAHHA 163
gi 499371538  86 cLDSGALVQPEALLGRLENLPARVLLRTYPQAPLSaWDPDFTAVAPATVELLASLGVRLIGIDTPSLDPQQSKTMDAHNT 165
gi 499309939  84 cVGVAR-VEPEHVRDALDGAPPRVLLRTYARMPQNaWDDHFAAVAPETIGLLAAHGVRLIGTDTASLDPQTSKTMDAHHA 162
gi 499564724  89 -LSKYEKIDKAALRSLHLEGVKRLLIKTAVPNQATaFPENIPYVTPDGAAYMKEKGIILIGVDVPSVDPLDSKELEGHHA 167
gi 499377585  83 -LSAFDEIDETALKSKVKEDTERLLIRTSLPNNPEqFPTDVTPITSDGAAYMHFLGVKLVGVDTPSVDPLSSKELVGHHA 161
gi 490669243 112 cIGARSAVTPEHVRAALAGAPPRVLLRTYGQAPQHaWDSAFCAVAPETIDLLAAHGVRLVGIDTPSLDPQESKTMDAHRR 191
gi 489907096  83 aIGCGPLILPEHLAHAQAGLPPRVLVRTARHAALQwWVDDFSAYAPQTIEWLAGRGVTLIGIDTPSIDPASSKTLDSHHA 162
4COB_A        87 cIGANPLVTPEHLAGQLDDLPSRVLLRTFERVPAN-WPEGFCAIAPATIECLAERGVRLVGIDTPSLDPQHSKTLDAHHA 165
                        170       180       190       200
                 ....*....|....*....|....*....|....*....|....*.
4CZ1_A       164 LFKHSIHILENVVLDHVADGDYELIALPLALSDADGSPVRAVIRPI 209
gi 489205815 164 VGRHGMAILEGVVLDDVPAGDYELLALPLKFTHLDASPVRAVLRAL 209
gi 499371538 166 VARHGMAILEGVVLDEVAEGDYELIALPLRFAHLDASPVRAILRPL 211
gi 499309939 163 VGRHGLAILEGLVLDDVPAGDYELIALPLKFATLDASPVRAVLRRL 208
gi 499564724 168 LADNGISILENLMLDKVKEGDYELIALPLPMEEADGSPVRAVIRAI 213
gi 499377585 162 LFKHDINILENVMLDQVVEGDYEMIALPLPLQDADGSLVRAVIKPI 207
gi 490669243 192 IRAHRMAILEGLVLDEIAAGDYELIALPLKFTTLDASPVRAVLRAL 237
gi 489907096 163 IRRHDMRVLENLRLDDVDEGDYELIALPLALVQADASPVRAVLREL 208
4COB_A       166 VGRHGMAILEGVVLDDVPAGDYELLALPLKFTHLDASPVRAVLRAL 211
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap