2WSC


Conserved Protein Domain Family
PS_I_psaG_plant

?
TIGR03051: PS_I_psaG_plant 
Click on image for an interactive view with Cn3D
photosystem I reaction center subunit V, chloroplast
Statistics
?
PSSM-Id: 132095
View PSSM: TIGR03051
Aligned: 7 rows
Threshold Bit Score: 122.239
Threshold Setting Gi: 131191
Created: 8-Oct-2014
Updated: 11-Oct-2014
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2WSC_G       76 VISLSTGLSLFLGRFVFFNFQRENMAKQ-VPEQNGMSHFEAGDTRAKEYVSLLKSNDP---VGFNIVDVLAWGSIGHIVA 151
gi 131194    76 VISLSTGLSLFLGRFVFFNFQRENMAKQ-VPEQNGMSHFEAGDTRAKEYVSLLKSNDP---VGFNIVDVLAWGSIGHIVA 151
gi 20143884  67 VISLSTGLSLFLGRFVFFNFQRENVAKQgLPEQNGKTHFEAGDDRAKEYVSLLKSNDP---IGFNIVDVLAWGSIGHIVA 143
gi 131192    51 VISLSTGLSLVMGRFVFFNFQRENVAKQ-VPEQNGKTHFEAGDERAKEFAGILKSNDP---VGFNLVDVLAWGSIGHIVA 126
gi 17369611  21 IISASTAALLALGRFVFLPFQRSMVSRHgLPEQNGVPTTRRVTAVRRRWWSMLKTNDP---AGFTLVDVLAWGALGHAVG 97
gi 131191    37 VISGSTAAFLAIGRFVFLGYQRREANFDs---TVGPKTTGATYFDDLQKNSTIFATNDp--AGFNIIDVAGWGALG--HA 109
gi 12831160  33 AIGGSTVSFLALGRFVFLPYQRRRTEMEvGPGRLGPKTTGDTFFDRLQEACFLRGDQDkgpSGFGLIDVIGWGALATRRL 112
                        90
                ....*....|....*...
2WSC_G      152 Y-YILATAS-----NGYD 163
gi 131194   152 Y-YILATAS-----NGYD 163
gi 20143884 144 Y-YILATSS-----NGYD 155
gi 131192   127 Y-YILATTS-----NGYD 138
gi 17369611  98 F-FILATAT-----NGYN 109
gi 131191   110 VgFAVLAINs---lQGAN 124
gi 12831160 113 VlFFFLPENqviahWGVR 130
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap