Conserved Protein Domain Family
PS_I_psaI

?
TIGR03052: PS_I_psaI 
photosystem I reaction center subunit VIII
Members of this protein family are PsaI, subunit VIII of the photosystem I reaction center. This protein is found in both the Cyanobacteria and the chloroplasts of plants, but is absent from non-oxygenic photosynthetic bacteria such as Rhodobacter sphaeroides. Species that contain photosystem I also contain photosystem II, which splits water and releases molecular oxygen. [Energy metabolism, Photosynthesis]
Statistics
?
PSSM-Id: 132096
View PSSM: TIGR03052
Aligned: 12 rows
Threshold Bit Score: 34.625
Threshold Setting Gi: 1346829
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30
                ....*....|....*....|....*....|.
gi 131202     4 SYLPSIFVPLVGLVFPAITMASLSIYIEQDE 34
gi 1346829    3 SNLPSILVPMVGIVLPAIVMALLFVYIETDE 33
gi 1346830    4 AFLPSILVPLVGLIFPAFSMALFFIYISADD 34
gi 1709820    4 AYLPSILVPLVGLIFPALGMALLFIYIERET 34
gi 131203     4 LNLPSIFVPLVGLVFPAIAMTSLFLYVQKKK 34
gi 131206     2 INLPSLFVPLVGLLFPAVAMASLFLHVEKRL 32
gi 61230069   8 SFLPWIFIPVVCWLMPTVVMGLLFLYIEGEA 38
gi 33633427   8 AWLPAIFVPITGIVFPAVFIVLVGRVITAAE 38
gi 18202235   8 TWLPAVFVPLIGLVTPAVFIVLIGRYITATD 38
gi 33635618   8 TWLPAVFVPLIVLVTPAIFIVLVGRHITATD 38
gi 3287267    7 TFLPSIFVPLIGLVTPAVFLVLIGRLITATD 37
gi 499937635  8 AWLPVLFVPMIGIVFPAVFIILVGRAITAAD 38
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap