Conserved Protein Domain Family
bchO_mg_che_rel

?
TIGR03056: bchO_mg_che_rel 
putative magnesium chelatase accessory protein
Members of this family belong to the alpha/beta fold family hydrolases (pfam00561). Members are found in bacterial genomes if and only if they encoded for anoxygenic photosynthetic systems similar to that of Rhodobacter capsulatus and other alpha-Proteobacteria. Members often are encoded in the same operon as subunits of the protoporphyrin IX magnesium chelatase, and were once designated BchO. No literature supports a role as an actual subunit of magnesium chelatase, but an accessory role is possible, as suggested by placement by its probable hydrolase activity. [Energy metabolism, Photosynthesis]
Statistics
?
PSSM-Id: 132100
View PSSM: TIGR03056
Aligned: 3 rows
Threshold Bit Score: 439.326
Threshold Setting Gi: 77463845
Created: 8-Oct-2014
Updated: 11-Oct-2014
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 499707512  16 TWPHRDCSRFVTVGGFHWHVQSMGPTAGgngkggdaPLLLLVHGTAATTHSWRDLMGPLARSFRVVAIDLPGHGFTRAPF 95
gi 502831443   9 NWPYRSAAARRRVGPIDWWVIDTGPADG--------PVLLLLHGLGASGHSFRKMIPGLSARYRVIVPDLPGHGCSRSTA 80
gi 499657384   9 DWPGRESMRRIDCPPHQWCVRDEGR--G--------PTALLLHGAGGSSHSWRHLVPLLAPHFRVVAPDLPGQGFTRAGQ 78
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 499707512  96 SFRPTLPSMAKALSALLAAEGLSPDGVVGHSAGAAILARMVLDGSVtPRmLVSINGAFMPFPGMAGTLFPYMARVLFCNP 175
gi 502831443  81 RNRFGLKPMAEDLWKLCQHLNVTPAAVIGHSAGGAIALQLALDTPV-PR-VVGINAALDHFEGVAGVVFPMMARGLAALP 158
gi 499657384  79 R-RFSLEAMAEDLARLCAAEDWRPSVLIGHSAGAALALRLAEILPVrPRaVVGINAALGNFEGTAGWLFPLIAKLLALNP 157
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 499707512 176 LTPYMMSWGAADQQRVERLIRDTGSLLDKPGMTYYGRLMRSPAHVSSALSMMAHWDLAPLNRDMRRLTIPLHLIVGEEDK 255
gi 502831443 159 FTAPLVTRFGASRQRIGQLLDMTGSVIDAAGKAYYTALIQTPEHVDGGLRMMAQWELGPLIGALPRIAKPVFLIAGNGDR 238
gi 499657384 158 FIPPMAARLFGAEDRVRRLIGSTGSDLDEAGLRQYMTLIGDHVHVDGTLSMMAQWRLDALQRRLPAIDVPTLLIAAAKDG 237
                        250       260       270       280
                 ....*....|....*....|....*....|....*....|....*.
gi 499707512 256 AVSPDEAKRLATRVATATLHVVPGgGHLVHEEQPDLVVGLIEQAAR 301
gi 502831443 239 AVPAHVSADAARFLPMATLRRIDG-GHLIHEVAADGLSGMILDWLE 283
gi 499657384 238 TVPPRISQEAAGRMPFGSYVEMPGlGHLAHEEDAAGVAAILLPFVE 283
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap