Conserved Protein Domain Family
srtB_sig_QVPTGV

?
TIGR03065: srtB_sig_QVPTGV 
sortase B signal domain, QVPTGV class
This model represents a boutique (unusual) sorting signal, recognized by a member of the sortase SrtB family rather than by the housekeeping sortase, SrtA.
Statistics
?
PSSM-Id: 132109
View PSSM: TIGR03065
Aligned: 2 rows
Threshold Bit Score: 57.5977
Threshold Setting Gi: 21909636
Created: 8-Oct-2014
Updated: 11-Oct-2014
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30
                 ....*....|....*....|....*....|..
gi 553743228 191 QVPTGVVGTLAPFAVLSIVAIGGVIYITKRKK 222
gi 544867387  98 EVPTGVAMTVAPYIALGIVAVGGALYFVKKKN 129
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap