1CUR


Conserved Protein Domain Family
rusti_cyanin

?
TIGR03095: rusti_cyanin 
Click on image for an interactive view with Cn3D
rusticyanin
Rusticyanin is a blue copper protein, described in an obligate acidophilic chemolithoautroph, Acidithiobacillus ferrooxidans, as an electron transfer protein. It can constitute up to 5 percent of protein in cells grown on Fe(II) and is thought to be part of an electron chain for Fe(II) oxidation, with two c-type cytochromes, an aa3-type cytochrome oxidase, and 02 as terminal electron acceptor. It is rather closely related to sulfocyanin (TIGR03094). [Energy metabolism, Electron transport]
Statistics
?
PSSM-Id: 132139
View PSSM: TIGR03095
Aligned: 5 rows
Threshold Bit Score: 222.455
Threshold Setting Gi: 19857494
Created: 8-Oct-2014
Updated: 11-Oct-2014
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1CUR_A        14 QVKAMLEKDTG---KVSGDTVTYSGKTVHVVAAAVLPGFPFPSFEVHDKKNPTLEIPAGATVDVTFINTNKGFGHSFDIT 90
gi 24475561   48 QVKALLAKDSG---KVSGKTVTYSGKTVHVVAAAVLPGFPFPSFEIHDVKNPTLDIPAGATVDITFINTNKGFGHSLDIT 124
gi 499220168  43 ELNSLNITPPGvqvSSNQSAIYINNSTTLPVLMGPMYAPSMYSFEILRLINPTIVVKEGVSVHFIVINVDTDSYHNFAIS 122
gi 499204364  47 QLESLNVTGPGvyiSPANSTIYVNNSTTLLVMAGPMDGPSMYSFEIEGLFNPTIVIREGVTVHFVVVNIDTDSEHNFVLS 126
gi 19857494   46 QVKAMLEKDTG---KVSGDTVTYSGKTVHVVAAAVLPGFPFPSFEVHDKKNPTLEIPAGATVDVTFINTNKGFGHSFDIT 122
                         90       100       110       120       130       140       150
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|...
1CUR_A        91 KKGPPYAVMPVID-------PIVAGTGFSPVPKDGKFGYTDFTWH-PTAGTYYYVCQIPGHAATGMFGKIVVK 155
gi 24475561  125 KKGPPYAVMPVIN-------PIIAGTGFSPVPKSGGFGYTDFTWR-PAAGTYYYVCQIPGHAATGMFGKIVVK 189
gi 499220168 123 NRGPPYPYMVGMMg-----lGFEYKAPYLPPVHSDLYAYSEFNYTfSSIGDYWYLCTYPGHAENGMYGEIIVR 190
gi 499204364 127 TRGPPYPYMSGMEymgsggfGFMTYMGFLPPTNSGHFYYYDFSYAfSQSGTYWYLCTYPGHAENGMYGKIVVD 199
gi 19857494  123 KKGPPYAVMPVID-------PIVAGTGFSPVPKDGKFGYTDFTWH-PTAGTYYYVCQIPGHAATGMFGKIVVK 187
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap