Conserved Protein Domain Family
nitroso_cyanin

?
TIGR03096: nitroso_cyanin 
nitrosocyanin
Nitrosocyanin, as described from the obligate chemolithoautotroph Nitrosomonas europaea, is a red copper protein of unknown function with sequence similarity to a number of blue copper redox proteins. [Energy metabolism, Electron transport]
Statistics
?
PSSM-Id: 132140
View PSSM: TIGR03096
Aligned: 3 rows
Threshold Bit Score: 258.379
Threshold Setting Gi: 77164600
Created: 9-Oct-2014
Updated: 11-Oct-2014
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 488897650   2 KITKAIFISFALGLLLMGTAQAKDvkaQSFTVVINAYDTNIPKLEVEGVTVKDIRAFNVLNEPEALVVRKGTPVEITVEN 81
gi 499700195   3 KINKAMFAGLAFGMLLTGAVHAAE---QKFTVVINAYDTTIPELNVEGVTVKNIRAFNVLNEPEALTVKKGNTVKVTIEN 79
gi 499423326   2 KTTKAMLAGFAVGSLLLAGAAQAE---HNFNVVINAYDTTIPELNVEGVTVKNIRAFNVLNEPETLVVKKGDAVKVVVEN 78
                         90       100       110       120       130
                 ....*....|....*....|....*....|....*....|....*....|....*...
gi 488897650  82 KSPISEGFSIDAYGISEVIKAGETKTIKFKADKAGAFTIWCQLHPMNIHLPGSLNVVE 139
gi 499700195  80 KSPISEGFSIDAYGIKEVIKAGETKTVSFKADKVGAFTIWCQLHPKNIHLPGSLNVID 137
gi 499423326  79 KSPISEGFSIDAFGVQEVIKAGETKTISFTADKAGAFTIWCQLHPKNIHLPGTLNVVE 136
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap