Conserved Protein Domain Family
PEP_O_lig_1

?
TIGR03097: PEP_O_lig_1 
probable O-glycosylation ligase, exosortase A-associated
These proteins are members of the O-antigen polymerase (wzy) family described by pfam04932. This group is associated with genomes and ususally genomic contexts containing elements of the exosortase/PEP-CTERM protein export system, specificially the type 1 variety of this system described by the Genome Property, GenProp0652.
Statistics
?
PSSM-Id: 132141
View PSSM: TIGR03097
Aligned: 5 rows
Threshold Bit Score: 532.781
Threshold Setting Gi: 83594424
Created: 8-Oct-2014
Updated: 11-Oct-2014
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 499650076   4 RDILITGVIFALLPVCFLRPWIGILVWTWISIMNPHRLTWGFAWDMPFAQLVAIAILGGMLLVRD-RKSIAWTPELRLLL 82
gi 499630076   2 RDIFVVSVIFGLLPFVLRRPWLGILLWSWLGYMNPHRLAWGFAYNLPFSMIVGLVTIAAFMASKE-KKEMPWTRETIFLL 80
gi 500031552   2 RDLILTLFIVGSLPYAFMRPSYGLLMWALLSYMNPHRLTWSYAYDFRFNFLVAFVTLAGVFFNKEvKFRIPIHGTTIFWM 81
gi 499425073   2 RDLLIVSIVAVMAVMALRRPWVGVMLWTWLSIMNPHRYSWGFAYSAPLAAVAAGVALLGLAFTKE-RQSPFQGAPVAWFA 80
gi 499710108   2 RDLLLALLLVSSLPLIIVRPYVGVFVWCVVSLMNPHQMAYGFISSAPVALLVAGSTLIGLLASRE-PKRLPGDPIVICIL 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 499650076  83 VLFGYMTFTTFFAWAPDAAWQQWDKVAKIFLMSYVTTILIYGKQRIYWLLLVATLSLGFYGFKGGLFTILTGGQFHVMGP 162
gi 499630076  81 IFVAWMLFTTLFAFYPDVAWMQWDKVWKIQLMIFLTALIINDRDKLHWLLWVIVLSFGFYGIKGGIFTIINGGAYRVQGP 160
gi 500031552  82 FFCLWTVVTSFNSFDPDRAFSEFDRFLKIQLMVLITFFLIKDRKWMDWLIWVIVLSIGVWVMKGGLFTLTSGGNFRVYGP 161
gi 499425073  81 LLTIWITLSWLFGYDPAGDYVQWSKVMKIYFMTFVALMLLSNKYHLMAFAWVTVGSLALLGAKGGFFTVLHGGNYRVWGP 160
gi 499710108  81 LLAFWVSVTTVFALRPDVAFPLWDRTIKMFLMVLVGLALIRSRQRLHALVWILVVSIGFYGVRGGLFTLVTGGGGRVVGP 160
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 499650076 163 PKSFLAGNNFLGLAMVMGLPLLLVFAQQEARVWFRRLLYATFALTFIAVPFTYSRGAMLGLAVVSVLLFMRWRNKALLVI 242
gi 499630076 161 SETFITGNNELALALVMTIPLIRYLHLQDTRKWMKTGLAAAMVLTGVAAIGSQSRGGLVAMVAMGIFLWLKSRNKIVTGL 240
gi 500031552 162 ARSFITDNNALALAVLMGLPLTFYIRQFAKRLWQKQLALVLIIFSVITVVGSYSRGGMLGLVVVLGVLFGRSRRGMIVFL 241
gi 499425073 161 PGSFIADNNHFALALIMTVPLLHFLQLQLQKPWQRHLMTVTMLSCVASALGSHSRGALLAISAMGAVLWWRSNRKGLMSF 240
gi 499710108 161 PTTMIGDNNSLAAALIMTLPLMRYLHLQSANRWIRLGLAGAMGLTALSVLGSFSRGALLASVAMFFWMLVRSRKRLMILA 240
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 499650076 243 MLIPILFGGLAFVPEKLFNRAESI----QNYE--MDASSMQRIAAWDLAWNIAIDRpLRGGGFEYeGDTARWHTYLDpky 316
gi 499630076 241 YMAVAVGIIAAVMPQEWYDRMNTI----NTYQ--DDQSAQGRINAWHTAFNVAKDR-VTGGGFEM-WRPPVFRQYAP--- 309
gi 500031552 242 LGVVLVALSYTSMPKHWQERMDDFfaisTAYElrEDASMMGRLNSWVLAWELAKDRpFVGGGFNT-FTAERFQTYAP--- 317
gi 499425073 241 GVLVVLLLLLPMMPEEWWARMGTI----QTYE--EDASAMGRINGWLVAIEVAKHY-LFGGGMSY-QHEFFFSMWGV--- 309
gi 499710108 241 LGATFAIGGLFLMPESWHDRMNTI----SDYQ--EDESAMGRLDAWTFAFNLAVERpLVGGGFRInVDRDVFLRFSP--- 311
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 499650076 317 yyVMEGAHVAHSIYFQMLGQHGFVGLSLFMIILFLTYRRLGRLKKWTLEISDLRWIGQYAWALRVGLVGYAVTGAFLNLA 396
gi 499630076 310 --DPYNVRDVHSIYFEIMGEQGFIGFALFMLLGLLAWLRAQQIIKRCKKDPDKKWAADLAAMIQVSLIGYAAGGAFLGMG 387
gi 500031552 318 --VPFERHDAHSIYFEVMAEHGFFGFALFIGMHLFAVLLGFKVKHLARGKPELDWAVTLATMLQISLLGYYVAGVFLGLA 395
gi 499425073 310 --YNTNVIAAHSIYFQILGNHGFIGLALYLGLWASTLWQAGWLRRHARSIPEAKWTVDLGSMVQVSLIGFAVGGAFLSMP 387
gi 499710108 312 --EAGINRAFHSIYFQVLGEHGFVGLGLFLATLALGFFKAGALSRQCAGDPKLAWARDLGAMSQVSLVGYAAGGAFLDLA 389
                        410
                 ....*....|....*
gi 499650076 397 YFDLYYLFVVLAALL 411
gi 499630076 388 YFDLPYHLMVILVLV 402
gi 500031552 396 YFDLPYHLISILVML 410
gi 499425073 388 YFDLPYNLMVLVVLA 402
gi 499710108 390 FFDLFYFVALLPVMA 404
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap