Conserved Protein Domain Family
dCO2ase_PEP1

?
TIGR03099: dCO2ase_PEP1 
pyridoxal-dependent decarboxylase, exosortase A system-associated
The sequences in this family contain the pyridoxal binding domain (pfam02784) and C-terminal sheet domain (pfam00278) of a family of Pyridoxal-dependent decarboxylases. Characterized enzymes in this family decarboxylate substrates such as ornithine, diaminopimelate and arginine. The genes of the family modeled here, with the exception of those observed in certain Burkholderia species, are all found in the context of exopolysaccharide biosynthesis loci containing the exosortase/PEP-CTERM protein sorting system. More specifically, these are characteristic of the type 1 exosortase system represented by the Genome Property GenProp0652. The substrate of these enzymes may be a precursor of the carrier or linker which is hypothesized to release the PEP-CTERM protein from the exosortase enzyme. These enzymes are apparently most closely related to the diaminopimelate decarboxylase modeled by TIGR01048 which may suggest a similarity (or identity) of substrate.
Statistics
?
PSSM-Id: 132143
View PSSM: TIGR03099
Aligned: 6 rows
Threshold Bit Score: 580.16
Threshold Setting Gi: 83594465
Created: 8-Oct-2014
Updated: 11-Oct-2014
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 499457662  20 FVIKDDCLEIGGIPLTRLETQIGQTPFFAYSRKHIDQQVCLLRKYLPEKISIHYAIKANPFVPLIHHLSQKIEGFDVASA 99
gi 499650078  13 FPIKNDCLLVGGVPLTEFAARVGSTPFYAYERRLISERIQHLRTHLPSEIYIHYALKANPMPALAGHIAPLVDGLDVASL 92
gi 499557459  19 FSVAKGELVVGGISLTRLAARVGRTPFYAYDRGLLTQRVSELRTALPREVRLHYAMKANPMPALVCHMAKLVDGIDVASA 98
gi 490647936   3 LTEQNGKTCLRNICFEELAARYG-TPFYLYDLDKVKEKCAAVRKAFGDSLELLYAVKANPNRELLAAMRGEVDGLDIASA 81
gi 499765246  11 YETIDGELAVDGHKVTDLVMQAGGTPLFVYSRALLTRRVQDLRAAMPERLAIHYAVKANPYIPLLSHMLELVDGFDIASG 90
gi 499710149   9 FGVSGSDLTIGGQRVSHLARIAGGTPFYAYDRGAVSARIAALRAALPAGMAIRYSLKANPMAALLAHMAPLVDGFDAASA 88
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 499457662 100 NEMALALNTGVSPEDISFAGPGKTDTELKRAIAAQV-LLNVESLNELRRIQILSEKLGLCARVSLRINPDYNLNSSGMKM 178
gi 499650078  93 GELRVALDTGTPPESISFAGPGKSDAELAASLAAGI-TINMESEGEMERIAHLAEKQGRRPRVAVRVNPNFELKTSGMKM 171
gi 499557459  99 GELKVALDAGADPGEISFAGPGKQDAELQQSVAAGI-LVNLESFREIAPLVAASVALGLPARVAVRVNPDFELKSSGMKM 177
gi 490647936  82 GELERALETGYDAGCISFAGPGKTRDELRRSLEAGVgCISVESLRELNDLRDLVRAGSHRAYILVRVNPQLLIRDFAVKM 161
gi 499765246  91 GELAIVRDAGIDPAMVSFAGPGKRDAELEAAIAAAV-TLNLESEGEATRALAIAGRLGIVPRLAIRVNPDFDLKGSGMKM 169
gi 499710149  89 GELRAGLAVGMAPAALSIAGPGKSPADILSAVAAGA-LVVVESLAEVGRVAQAGNASGLRPRVLVRVNPEAEIQGAGLRM 167
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 499457662 179 GGGPRQFGMDVVYVPEALMFIRDYpdSLVFEGFQIYPGSQNLCAEHLIEAQNKALNLVIELSHSAPSPVRRFNLGGGFGV 258
gi 499650078 172 AGGPKPFGVDAERVPAMLARINTL--DLDFQGFHIFSGSQNLRAEAIIEAQERTFTLALELARSAPTPVRLLNIGGGFGI 249
gi 499557459 178 GGGPKQFGVDAEQVPQLLAEIGRA--GLAFEGFHLFAGSQNLKAEAIVEAQRKSFELALRLAEHAPAPVKFLNLGGGFGI 255
gi 490647936 162 GGKASQFGIDEEELPSALDFIKANadAFDFKGIHIYAGTQCLNEEALAQNLANTLAIAARITTDYGMECRVINIGGGLGV 241
gi 499765246 170 GGGAKPFGIDAERVPALARKLISA--GAEWRGFHIFAGSQALSADAIIETQAQTIGLAARLAEETGAPLPKCNLGGGFGI 247
gi 499710149 168 GGGARPFGIDADQVPGVLAAIAAH--DLDYQGLHCFWGSQALDAERIARAFAVVGQTLLDLA--GPRPPRQIVIGGGFGI 243
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 499457662 259 PYFQGNTELNITEVGNAMHKLVERAEKFL-PEVEIILELGRYLVASSGIYVTKIVERKISHDMTFLVTDGGMNHHLSASG 337
gi 499650078 250 PYFPGNKPLDLRPIADNLAASLPKLQRQI-PEAEVTLELGRYLVGEAGIYVCEIIDRKISRGHVFLITNGGLHHHLAASG 328
gi 499557459 256 PYFPGEQRLELAPIGDNLAALVAEAARKL-PQAQLVIELGRYLVGEAGIYVCRVIDKKVSRGHTYLVTDGGLHHHLSASG 334
gi 490647936 242 SYYEEHPGLDLDKLALLFRAEFDRYREATgTKPRILLELGRFLVAEAGIYVTRVVSEKLSRGEQFYVLDGGMNHHLSASG 321
gi 499765246 248 PYFPGDEPVDVVAVGAALGDQFAALPDVL-RDTAFCIELGRYLVGEAGIYLATVIDRKESHGEVYLVTDGGLHHQLAASG 326
gi 499710149 244 PYTPTSAPLDLARAGAAVAETAGLLGDHL-PGVSLGLELGRFLVGEAGVYVCAIRESKRSRGNLFLVTDGGLHHNQAATG 322
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 499457662 338 NLGQLIRRNYPAIIGNKIKGEKRETVNIVGPLCTPLDILVHQGDMSVATPGDLVVIFQSGAYGLSASPNNFLSQTNAVEV 417
gi 499650078 329 NFGQVIRKNYPVVVGNRIQGSTREIASVVGPLCTPLDLLADRMELAQAEAGDLIVVFQSGAYGRSASPLGFLSHPVPAEV 408
gi 499557459 335 NFGQVIRKNYPVAIGNRMGDAATENYSVVGPLCTPLDLLGEKINLPQVQPGDLVVIHQSGAYGASASPTGFLGHPEIIEI 414
gi 490647936 322 NLGMTIRKNYLVRNLSR-PGAERIICTLVGPLCTPLDLMGKGVTVEVPEVGDLVGFLNSGSYGYSASPLLFLGHGEPCEL 400
gi 499765246 327 NFGTVVRRNYPSAIATRFGAAVEEEASIVGCLCTPLDRLADKGGFPRTDTGDLVVIFCAGAYGASASPAAFLGQGPAREM 406
gi 499710149 323 NFGQVVRRPYPLVIATRMGEPVSERATITGCLCTPLDVFAEALAIPAAAEGDLVAIFQSGAYGASASPSAFLGHPPAVEL 402

                 ..
gi 499457662 418 LV 419
gi 499650078 409 LV 410
gi 499557459 415 LT 416
gi 490647936 401 LV 402
gi 499765246 407 LV 408
gi 499710149 403 LV 404
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap