Conserved Protein Domain Family
hydr1_PEP

?
TIGR03100: hydr1_PEP 
exosortase A system-associated hydrolase 1
This group of proteins are members of the alpha/beta hydrolase superfamily. These proteins are generally found in genomes containing the exosortase/PEP-CTERM protein expoert system, specifically the type 1 variant of this system described by the Genome Property GenProp0652. When found in this context they are invariably present in the vicinity of a second, relatively unrelated enzyme (ortholog 2, TIGR03101) of the same superfamily.
Statistics
?
PSSM-Id: 132144
View PSSM: TIGR03100
Aligned: 5 rows
Threshold Bit Score: 317.91
Threshold Setting Gi: 87200356
Created: 8-Oct-2014
Updated: 11-Oct-2014
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 499607430   4 TERAFTFSCSGEALLAILAEPEASG-QTGVLIVVGGPQYRVGSHRQFVLLSRALADAGFPVLRFDSRGMGDSTGVFGGFE 82
gi 499650080  38 AEEALTFHCLGELLVGILHRGSEYA-TRGVLVVVGGPQYRVGSHRQFVLFARWLAEAGVPVFRFDYRGMGDSGGGTRTFE 116
gi 499557463   4 REIPLVFSCGSEPLIGVLHIPNRPA-RLGVIVIVGGPQYRVGSHRQFLLLARELASGGFACLRFDYRGMGDSASNLCTFE 82
gi 499710138  10 AEEALSLTCEGSSLIGVFHPTAKPHpTVGLIIVVGGPQYRVGAHRQNVRLARHVAEAGFPVLRFDLRGMGDSEGTAPGFE 89
gi 499765251   2 TRRHLTFACEGATLVGTLDIDGASH-GTGLLIVSGGNELRAGAWSGQAQLATRLAHAGFPVFRYDRRGVGDSEGENLSFR 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 499607430  83 QIDEDIAAAIDAFFENCPQVERIVVWGLCDAASASLLYwdATHDERVCGLVLLNPW----VRSEATLAKTHIKHYYGQRL 158
gi 499650080 117 NIEVDIRAAIDAFLEAAPGLREIVIWGLCDAASAACFY--APSDPRVAGLVLLNPW----VRTEEGQAAVYLKHYYFRRL 190
gi 499557463  83 DVDADIHAAIDALLEACPELEGVVLWGLCDGASAALMY--APLDARVKGIVALNPW----VRTDASLATARLNHHYKRQI 156
gi 499710138  90 ASRADITAALAGLRAWVPSLRQIVAWGLCDGASAVLLD---LDHVPLAGAILVNPW-----AQEAEQAPLRDRLYYRGQL 161
gi 499765251  81 GALPDIAAALAAFRSAAPHLSRIVAFGNCDAAAALMLF--G-AELQVDGLVLANPWtidgEEAPDAMPASAIRSRYLGKL 157
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 499607430 159 LQA-DFWRKMLTGKLGFSSSLKGFISSV---LNARQQGKKV--VDGKklpFQEKMARGLERFSGPALFVLSGNDFTAKEF 232
gi 499650080 191 VSG-DFWRKFWRREFDYKDSLRSLGDILrkaNSWRQKVDEV--ETEEilpLPKRVYKALEQFQGRTLLILSGKDLTANEF 267
gi 499557463 157 LSA-HFWRRLLSGEVRLARSLLGLADAIr--KAARQKGRAAnrAPQS---FLERMNAGCQRMQGKVLFVLSGNDLTAREF 230
gi 499710138 162 RSK-AFWGKLLRGDLPWRSALRGLGG-L---LKRAPRGDET--AQGG---LACRLRAALARHKVPLLVILADQDVTAGLF 231
gi 499765251 158 ASPrEIWR-LLSGGVNLGKLARGLRTA---------AGHSP--AHAG---LAQDMKAGLDAFAGPVAILLASRDRTAQMF 222
                        250       260       270       280       290
                 ....*....|....*....|....*....|....*....|....*....|
gi 499607430 233 LGALKTEPLWNAIQQRSHVEMVHVDDADHTFSSAVWRNAVATGVTDWLQR 282
gi 499650080 268 RDTISSSSAWRGLLRSRSIERRELSTADHTFSRRVWRDQVAQWTLEWVRS 317
gi 499557463 231 ADFCHARPEWRRALE-PGLNFVEIEGADHTFSTRKWKRSVEGATLNWVRN 279
gi 499710138 232 AASVLGSRRW------PGITVTSLPGADHTFSDPRHEQRLREITTQWLKA 275
gi 499765251 223 ------EEAWGG--EDPRIAR--IDSASHSFSDEAAREWLHARLVEALTR 262
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap