Conserved Protein Domain Family
trio_acet_GNAT

?
TIGR03103: trio_acet_GNAT 
GNAT-family acetyltransferase TIGR03103
Members of this protein family belong to the GNAT family of acetyltransferases. Each is part of a conserved three-gene cassette sparsely distributed across at least twenty different species known so far, including alpha, beta, and gamma Proteobacteria, Mycobacterium, and Prosthecochloris, which is a member of the Chlorobi. The other two members of the cassette are a probable protease and an asparagine synthetase family protein.
Statistics
?
PSSM-Id: 132147
View PSSM: TIGR03103
Aligned: 7 rows
Threshold Bit Score: 934.922
Threshold Setting Gi: 41407520
Created: 8-Oct-2014
Updated: 11-Oct-2014
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 489974630  31 MAKDVELELGWGRLIFGQTFANSQELVEALRREGPGRRDICIYARESHVVVAEAPTELFIDPSHTYRLRFTGKeKSLAPT 110
gi 500031199  32 MLDEAVIDCGWGKLVFGQTFSDNQALCQAMRAEQPGQRNVALYLRDPHVVLSLYPQELFLDPSHTYRLALTQDpWQDFTP 111
gi 499282282  46 AKRDVVLDCGWGRLLFAQTFSDDEKLLSELREEAPSSRDIAFYVRDPHVLLSRAPQEIFLDPSHTYRLDLWTY-RANTRR 124
gi 499714848  36 APSSVSVHCGWGRLLLANTFESPKELAKSLAEESTGDRDIALYVADPHVVLSHAPQSLFLDPSDTMRLWMSQY-RPRTRA 114
gi 499709007   8 FKKEASIDCGWGRLVFGQTFDGPGRLAEVMRTEGPERRDVAIYVRDPHVVLAMAPHEMFLDPSHTYRLDLARY-RPSARQ 86
gi 489345492  35 HDQPRAVHCGWGRLLIGHTYPDPASLAEDLLDEHPGERDIALYVAAPQQVLAQAPQQLFLDPSDTLRLWFTDY-RPAQRV 113
gi 499558014  29 MPDNVVIECGWGRLLPGQTWREPALLATELLQERAGQRDIAFYVEKPHVVVAAAPQQLFVDPSEAFRLSLGGY-RSARQT 107
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 489974630 111 PLGVTVRTLNDPIDADAMNRVYVRCGMVPAGVDVIWeNHQHVPAVKYLLAVRDEDGAVVGTVTGVDHELLFNDPEHGSSL 190
gi 500031199 112 PAALSILPIRGEQDMAVVRQLYETRRMVPPRAGFRL-DGQEGCAPLFLIAIDEQSEQIVGVVNGVDHRCAFNDPENGSSL 190
gi 499282282 125 TRGITIRRLASEADGDGVNRVYAACGMVQIRSDFFS-SERDDRSLTYFVAQDDATGEIVGTVTGIDHQRLFDDPDRGASL 203
gi 499714848 115 LPGVTVRRASSTVDVEALNAIFTQRKMVCAPVEHVL-AHRHSKDIVYLVAEALGSGKIIGTVMGVNHIKAFGDPSKGSSL 193
gi 499709007  87 PHGFTIRPLAGPGDVDDINRIYAARHMVAVRPDFFE-GPLASRGITLLVAEEGAGGRIIGTVMAIDHGRAFGDPARGSSF 165
gi 489345492 114 FRGFRVRRAQNPADWQAINTLYQARGMLPVDAE-LL-TPRHLGGPVYWLAEDEDSGAIIGSVMGLNHTKAFDDPEHGSSL 191
gi 499558014 108 RRGFTLRRLRTRADVAAINVLYRSRGMVPVDTQRVW-RERASRAITYAMAEDRTSGEIIGVAMGLDHVEAFADAQHGASL 186
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 489974630 191 WTLAVDPAAGLPGVGGALTRALAEHFRSAGCAYMDLSVAHDNAAAISLYEKLGFRRVPVLAIKRKNAINEPLFSPPPETV 270
gi 500031199 191 WALAVDRKTAIGGVGEALVRALAHHFWQQGRGYMDLSVMHDNEQAIALYNKLGFKQIPVYCLKNKNPINERLFSGPAPEA 270
gi 499282282 204 WCLAVHPQARQPGIGEHLVRKLAEHFQARGLSYVDLSVMHDNTLAIGLYEKLNFRRMPLFAIKRKNAINEKFFAMPHQSY 283
gi 499714848 194 WCLAVSPDSKTPGVGEALVRYLAEYFQTRECQYMDLSVLHDNYEAKALYEKLGFQAIRTFALKKKNAINEKLFVGPEPSA 273
gi 499709007 166 WCLAVDPQAIHPGIGEALVRAAVEQLAGAGATHTDLTVMHDNDQAIALYDKLGFERVDFFTMKRKNPINERLFTGPAPEA 245
gi 489345492 192 WCLAVDPHCTRPGVGEVLVRHLIEHFMSRGLAYLDLSVLHDNRQAKRLYQKLGFRNLPTFAVKRKNGINEQLFLGPGPQA 271
gi 499558014 187 WALAVAPQAAHPGVGESLVRYLAEHYQARGRISLDVSVMHDNCQAIALYEKLGFQRIPAFAVKRRNAINEPLFTGPEDGA 266
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 489974630 271 -DdLNPYARIIADEALRRGIWVEVLDAETGEMRLTHGGRSVITRESLSEYTSAVAMCRCDDKRLTRRLVSEAGITVPRAR 349
gi 500031199 271 -N-LSIYSRIIVDEARRRGISVEVLDQSLELFRLKLGGRTVLCRESLSSLTSATAMTVCDNKRLTSRLLKSAGLQVPEQM 348
gi 499282282 284 -DaLNPYARLIVDEATRRGIHVEITDAEGGFFRLSHGGRSIHCRESLSELTSGVAMSICDDKAITRRMVSAAGLVVPDQI 362
gi 499714848 274 -K-LNPYAKIIVNEAMRRGIEVVIDDEVNNLFTLSFGGRRIRCHESLTDMTTALSMSLCQNKMLTHRSCARAGLRTPIYQ 351
gi 499709007 246 -R-LNPYAEIIVTEARRRGIDVRVTDAEGGFFRLSFGGRSVHCRESLSELTSGVAVSICDDKAVTRRLVEAAGICVPEQI 323
gi 489345492 272 -D-LNPYARIIVDEALRRGIEVQVDDAAGGLFTLSLGGRRIRCRESLSDLTSAVTMTLCQDKRLTQHALHNAGLQVPAQQ 349
gi 499558014 267 qD-LNPYARLIVTEARRRGVLVEVLDAENGYFRLTLGGRSIVCRESLSELTSAIAMSRCQDKRVTLKLLREAGLRVPAQA 345
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 489974630 350 LAT-FDEGDFAFLKEVGEVVVKPTRGEQGKGITVGVTAengPDDLSAALARARAQYP--DVLIEQRVPGDDLRLVVIDGR 426
gi 500031199 349 VVG-KGERVENFLARHGAVVVKPVRGEQGRGISVDVRD---LTSLEQAIAKAQQEGDgeQVLLERLVVGDDLRIIVIGHE 424
gi 499282282 363 EVDeNGKAIQDFLKKHGKLVVKPARGEQGRGISVGITT---MEALEEAIASARQVCD--RVLLEAFFEGEDLRLVIIDYT 437
gi 499714848 352 LYR-SREQAEEFLADHGAVVVKPLDSEQGKGISVDVRN---VDDLHAAISKAESVSS--SVLLETYHPGFDLRVVVIDFD 425
gi 499709007 324 EAG-DGAAVRAFLAHHGSVVVKPARGEQGRGIAVGLDT---AEAVDAAIVTAGRFCE--RVLVERCAAGEDLRLIIIDFH 397
gi 489345492 350 LAG-NADDNLAFLEEHGAVVVKPVDGEQGQGVAVNLTC---IDDITRAVAHARQFDS--RVLLESFHAGFDLRIVVIGYE 423
gi 499558014 346 DAT-DAEANERFLAEHGAVVVKPVEGEQGKGISVDLRS---PDDVAAAIGRAHHFCD--RVILEQYCEGEDLRIVVIDFR 419
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 489974630 427 VVAAALRLPPEVIGTGEHSVRDLIAAESRRRSAATGGESRIPLDELTEATVAEAGWKLDDVLPQGTRLRVRRTANLHQGG 506
gi 500031199 425 VVAAAVRKPPMIRGDGHSNIAALIQRQSRRRAAATEGESRIPLDGETQRCVQEAGLEMHSILDKGQQLLVRRAANLHTGG 504
gi 499282282 438 LVAAAVRLPPRVIGDGRSKIASLIGKQSRRREAATGGESRIPLDAETDRCLAEQGLDLETILEEGREITVRKAANLHAGG 517
gi 499714848 426 TVAAAIRRPAEIYGNGRDSIRTLVEKQSRRRAAATGGESQIPIDAETERCIREAGYDWDSVLPVEAHLFVRRTANLHTGG 505
gi 499709007 398 LVAAALRRPPRVTGDAKTTLRDLIAVQSRRRAAATGGESSIPLDDETVRCLAASGFTLEDVPVEGCDIVVRRTANLHTGG 477
gi 489345492 424 VVAAAIRHPAQVLGDGKHSVRQLIEAQSRRRQAATGGESRIPLDDETERTLRAAGVGYDDVLPAGQRLAVRRTANLHTGG 503
gi 499558014 420 VVAAAVRRPPVVVGDGRSTVLELIEKQSRRRQAATGGESSIPVDEETERCLRMQGHGLEDVLDHDVQIRVRNTANLHTGG 499
                        490       500       510       520       530       540       550
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 489974630 507 TIHDVTAQVNSELCRVAVTAAEAIGIPVTGIDLLVPDVTGADYAFIEANERPGLANHEPQPTAAAFIDFLFPGHPGQ 583
gi 500031199 505 TIHDVTEQLHPALREAAEQASMVLDMPLVGLDFLVPDVQGPDYVIIEANERPGLANHEPQPTAKRFIDMLFPQTTLP 581
gi 499282282 518 SIHDVTEIVHPDLVEAACRAARAINIPVVGIDLMVRDPAEPDYVFIEANERPGLANHEPQPTAASFIELLFPGSRTA 594
gi 499714848 506 TLIDVTDDLHPELRAAAEEAARALQIPVVGMDFIVKDHTSPDYVIIEANERPGLENHAPQPTAQRFIDLLFPLTRSV 582
gi 499709007 478 TIHDVTDEVHPDLVAAGIRAARAIDIPVVGIDLLVRSPRAPDYVFIEANERPGLANHQPQPTAERFIDLLFPNSVPA 554
gi 489345492 504 TLEDVTERLHPVLADAAVRAARALEIPVVGLDFMVRDAGQPEYVIIEANERAGLANHEPQPTAERFIDLLFPHSRPL 580
gi 499558014 500 TIHDVTGELHPDLRDAAEAAARALDIPVTGLDFLVPAVDRGDYVIIEANERPGLANHEPQPTAERFIDLLFPRTRAA 576
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap