Conserved Protein Domain Family
eps_aminotran_1

?
TIGR03108: eps_aminotran_1 
exosortase A system-associated amidotransferase 1
The predicted protein-sorting transpeptidase that we call exosortase (see TIGR02602) has distinct subclasses that associated with different types of exopolysaccharide production loci. This model represents a distinct clade among a set of amidotransferases largely annotated (not necessarily accurately) as glutatime-hydrolyzing asparagine synthases. Members of this clade are essentially restricted to the characteristic exopolysaccharide (EPS) regions that contain the exosortase 1 genome (xrtA), in genomes that also have numbers of PEP-CTERM domain (TIGR02595) proteins.
Statistics
?
PSSM-Id: 132152
View PSSM: TIGR03108
Aligned: 7 rows
Threshold Bit Score: 1083.61
Threshold Setting Gi: 117923906
Created: 8-Oct-2014
Updated: 11-Oct-2014
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 499630071   1 MCGITGIFDTSGVNAISRDLLQRMNETQHHRGPDEGGLHLEPGLGLGHRRLSIIDLSSGQQPLANEDGSVVVVFNGEIYN 80
gi 488900355   1 MCGITGIFDLHERRPIDREILSRMNDIQRHRGPDGGGIHVEPGIGLAHRRLSIIDLSLGRQPLSNEDGTVWVTYNGEIYN 80
gi 499424879   1 MCGITGVFDTRSTSEIDRNLLHRMNETLTHRGPDEGEVYVESGLGLGHRRLSIMDVSSGQQPLFNEDGSVVVVFNGEIYN 80
gi 499557441   1 MCGIAGLFDLRGKRDFSRDLVRRMNDVQVHRGPDEGGYHFEPGIALAHRRLSIIDLSTGQQPLFNEDGSVAVVFNGEIYN 80
gi 499710135   1 MCGLVGIYHPTASRPVDRALVEAMNQRQFHRGPDDGGVFIGPGIGLGHRRLSIVDLGGGRQPMTNDGGGVVLVYNGELYN 80
gi 499765236   1 MCGIAGIVHTEGPKPVDPDRVRRMCDAIAHRGPDGEGVWTAPGIGLGHRRLSIIDLAGSPQPMKAAEGDAVIVFNGEIYN 80
gi 500031566   1 MCGLSAILDLTGQRLPEAEQLTAMTRALAHRGPDGEGMHREPGVGLGHRRLSIIDLAGGAQPLWNEDRSVAVVFNGEIYN 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 499630071  81 FQELVPELEALGHVFRTHSDTEVIVHAWEAWGEACVARFRGMFAFVLWDRNQETLFVVRDRFGVKPLYYAFLDTGEFIFG 160
gi 488900355  81 FKELMAELSHRGHVFRTQCDTEVIVHAWEEWGEKCVHHFRGMFAFAIWDRKQETLFLARDRLGIKPLYYALLPNGQLIFG 160
gi 499424879  81 FQKLVGELTALGHRFRTHCDTEVIVHAWEEWGERCVERFSGMFAFGVWDRNRQTLFMARDRLGIKPFYYTLLDNGLFLFA 160
gi 499557441  81 FQELVPELEALGHAFHTRSDTEVIVHAWEAWGEDCVQRFRGMFAFALWDRNRETLFLARDRLAVKPLFYALLPDGTFAFG 160
gi 499710135  81 NAELVAELKAAGHVFRTASDTETVIHAWEEWGEDSVRHLRGMFAYALWDDRSQTLFLARDRLGIKPLHYTCLADGRVMFG 160
gi 499765236  81 FRDLRKELQALGAQFRTDGDTEVILQAWRQWGTACLPRLHGMFAFALYDLRQRTTLLARDRLGVKPLFTARLADGAVIFG 160
gi 500031566  81 FPDLMQRLQGLGHQFHSRSDTEVIVHAWEQWGEQCVEALQGMFAFALWDRCQGVLFVARDRLGIKPLYYGFSEDGWLLVG 160
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 499630071 161 SELKSLMVHPSLGREVDPLAVEDYFAYGYVPEPRTIFKRVHKLPPGFTLTLKRGAPRALPKQYWDMPFA-PVAVKDEAGA 239
gi 488900355 161 SELKALITHPHLPRQLDSLAVEDYFAFGYIPDPRTIFRYANKLAPGHTLTLRCGASKLEPRQYWDVTLE-PQALGSESAI 239
gi 499424879 161 SELKALLVHPDFDKTFDHRAIEDYFAYGYIPEPKTIFKNAFKLNPGHLLSLQRGQQTVQSREYWDIPFT-PHGSLSEEEA 239
gi 499557441 161 SELKVLMQHPLLDRRIDAHAVEEYFALGYVAEPRTIFAGAKKLGAAETLCVRRGQPVPQPRCYWDVHFM-LDNPLSLAEA 239
gi 499710135 161 SELKSLTGVEDIPKVVDPLAIEDFLAYGYVPDPRSIFKDILKLEAGHTLTFRRGEAPGRPHCYWDVSFTtPSRPAKTDDL 240
gi 499765236 161 SELKALLAHPSLRREIDPLAVEDYLAWGYVPDHRSMLKGVEKLPAGHYQLLRHDAPPAAPVQWWDVSFA-DRANGSAEDL 239
gi 500031566 161 SELKALTAHPGLSRSLDPKGVMDYFAYGYIPDPHSIYRQVKKLEPGYCARFTLGSGDWRLRCYWDLSFA--AQPLTEAAA 238
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 499630071 240 MDELVERMKESIRLRMIADVPLGAFLSGGVDSSAVVAMMATQSSTPVNTCSIGFDDPAFNEIEYAQQVADRYHTRHHVET 319
gi 488900355 240 EETLIEKFREAVNIRLVADVPLGAFLSGGVDSSAVVAAMAQLSNDPVRTCSIGFSDPAFDEARYAEQVAHRYGTNHHSAQ 319
gi 499424879 240 AEELILRLRNAVDSHLMSEVPLGAFLSGGVDSSAVVAMMGGLMKEPVNTCSIAFSDPAFDESDYARLVAERYQTRHFTEQ 319
gi 499557441 240 SAELTARLRESVRLRMIAEVPLGAFLSGGVDSSAVVATMAGLSDEPVHTCSIAFDDPAFNESDFAQKVADRYRTNHYVET 319
gi 499710135 241 CAEVIDRLDEAVRCHLVADVPVGAFLSGGVDSSAMVALMAGATDRPVETCSIAFSEARFDESAYAKTVAERYGTHHRVHT 320
gi 499765236 240 GAHLLHHMRDAVTSRMVADVPLGAFLSGGVDSSSVVALMAEASATPVKTCSIGFDVAALDETAYADRIAARFATEHRKRL 319
gi 500031566 239 LQQLQELLGQTVQSHTLADVPLGAFLSGGVDSSLITALLAKQSQTPLQALTVAFTGSREDEAPHARAVAQHLGVQQQLLT 318
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 499630071 320 VAADDFSLVGKLAQVYDEPYADSSALPTYRVCELARKHVKVALSGDGGDEHFAGYRRYRWFRYEERMRSIIPLGLRRPLF 399
gi 488900355 320 VDQDDFELINRLAGVYDEPYADSSAMPTYRVCELARQRVKVVLSGDGGDELFAGYRRYRWHLHEQRVRGILPLSMRQPLF 399
gi 499424879 320 VQQDDFDLIDRLAALYDEPFADSSAIPTYRVCELARKRVTVALSGDGGDENFAGYRRYRWHMIEERLRSKLPLGLRKPLF 399
gi 499557441 320 VKSDDFDLIDTLAGLYDEPYADSSAIPTWRVCQLARKRVTVALSGDGGDESFGGYRRYRLHLMEERMRGALPLGVRQPMF 399
gi 499710135 321 LPAQALSEVGPLTAIYDEPFADSSALPTLKVCQAARETVTVALSGDGGDELFAGYRRYRFHTAEEAVRRILPQAARGPLF 400
gi 499765236 320 VSPDDFSLVDRLAGMFDEPFADASALPTFRVCELAREHVTVALSGDGADEAFAGYRRQTFQHREEQARALLPSALRKPLF 399
gi 500031566 319 VDPLDFERLERLPGLYDEPFADSSAWPTFLLCEAAASRMKVVLSGDGGDELCAGYSRYRLFMAEQQVRQRVPSWLRRGLF 398
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 499630071 400 GTLGLLYPKADWAPKMFRAKTTFEALARDTVEGYFHGVSLLSNAQRAQLFSPAFRRELQGYQAVDVLRRHAAVAPtDDPL 479
gi 488900355 400 GILGHYYPKLDWAPRIFRAKTTFQALARDPLEGYFHSVAVIPNELRHRLFSQRMRQELQGYEASQVLRNHARQAP-DHPL 478
gi 499424879 400 GLLGSVYPKADWAPKFLRAKTTFESLARDSVEGYFHSVSILDNKLRMQLFTRDFYRDLQGYRAVEVLRDYADKSPtKDAL 479
gi 499557441 400 GLLGRLYPKADWAPRMFRAKTTFQALARDSLQAYFHSVSILRDAMRRQLFSNRFRSELAGYNAIEVFRRHAATAHtDDAL 479
gi 499710135 401 GALGRVYPKLDWAPQVLRAKSTFQALGRDRVEGYFNAVSVIPDGLRRGLYSKTMRAELAGYGASEVLRRHMTRAPaDHPL 480
gi 499765236 400 GTLGRLWPKADWAPRPLRAKTTLLSLAASGEEGYARALSVTSPELRETLYTPDFKRLRGDYRAEQPLIELMRKAPaRSGL 479
gi 500031566 399 GPMGMLYPKLDNAPRWLRAKSTLQALGEGPLEGLFRGASMMDPAMGQGLLAPDLM--LLDYHPIEHFYRLNARLPeQVAF 476
                        490       500       510       520       530       540       550       560
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 499630071 480 -SLVQYLDMKTYLVGDILTKVDRASMAHALEVREPLLDHELMGWVSGLPVDLKLRGSEGKYLLKKAMEPYLPHDVLYRKK 558
gi 488900355 479 -LQVQYLDLKTYLPGDILTKVDRASMAHGLEVRVPLLDHPFVEWAGGLSPHFKYRSREGKYVFKRALRPYLSDEILYRRK 557
gi 499424879 480 -SLIQYLDMKTYLVGDILTKVDRASMAHSLEVRVPLLDHELVEWVSGLPASMKLRQQEGKYILKRSLEPYLPNEVLYRNK 558
gi 499557441 480 -ALIQYVDLKTYLVGDINTKVDRASMAHSLEVREPLMDHKLVEWLATLPSGLKVKGQEGKYLFKKAMEPLLPNDVLYRPK 558
gi 499710135 481 -SIAQYVDLKTWLPGDILTKVDRASMATSLEVRVPMLDHRFVEWTAGLSPDLKLSGGTGKYLLKRALRPLLPDEVLYRRK 559
gi 499765236 480 -DRAQYADLKFYLPGDILTKVDRTSMAVGLEAREPLLDHRLVEFGASLPERLRVRGATGKWLIKQTMRRYLPEDVLFRPK 558
gi 500031566 477 hDRMLYLDFKTFLAGRVLTKVDRASMAVGLEVRVPLLDHRLVEWAGRLPWCLKMQGGQGKYLLKKLAAQQVPATAVYRSK 556
                        570       580       590       600       610       620       630
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 499630071 559 MGFSVPLAAWFRGPLAATIRTVVLGERLAGTGMFNCEFLREVVEAHQSGRRDFSVILWTVLMFDAFLGQV 628
gi 488900355 558 MGFAVPLAAWFRGPLRERVRTAVTGQILAETGLFEMPILRHLVDQHLSGLRDYSASIWSLLMFDAFLRQA 627
gi 499424879 559 MGFSVPLASWFRGPLRERVRTALLGNTLAGTGIFDMGFIKKMLDQHQSGRRDYSAPIWTLLMFEAFLRNI 628
gi 499557441 559 MGFSVPLSRWFRGPLRERVRQTVLGETLAATGIFNPDYLRHLVDAHQSGARDYSSPLWSLMMFEAFVRSS 628
gi 499710135 560 MGFSIPLTDWLRGPWSGRTRALAGRSALVTSGLFDGAAVAKLVEQHLGGNWDHGAALYALIVLDDFLTAH 629
gi 499765236 559 MGFVTPLAQWLRGPLAHEARALASDGLLARTGWLDAARIDALADAHVSGRADHSRLIWQLLMLRKSLQLL 628
gi 500031566 557 QGFIPPLAAWLRGPLQERLQDRLSSRVITESGLFHPRWIHWMLEQHRKKKQDLSMPLWSLLMFEGMLRKA 626
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap