Conserved Protein Domain Family
glyc2_xrt_Gpos1

?
TIGR03111: glyc2_xrt_Gpos1 
putative glycosyltransferase, exosortase G-associated
Members of this protein family are probable glycosyltransferases of family 2, whose genes are near those for the exosortase homolog XrtG (TIGR03110), which is restricted to Gram-positive bacteria. Other genes in the conserved gene neighborhood include a 6-pyruvoyl tetrahydropterin synthase homolog (TIGR03112) and an uncharacterized intergral membrane protein (TIGR03766).
Statistics
?
PSSM-Id: 132155
View PSSM: TIGR03111
Aligned: 5 rows
Threshold Bit Score: 693.409
Threshold Setting Gi: 15895787
Created: 8-Oct-2014
Updated: 11-Oct-2014
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 499268486   6 GKTYREMVFWMAWIIIPFLMEIVPALGGFIILLRKRLSIKDKAFSGKLPQITIIVPVYNSEDTLKGCIESIYNSDYPSEF 85
gi 499268475   6 SKTLRELIFWMAWIIIPLIMEIIPAFGGFFILVKKSFNSNREGFIGTLPEITLIIPIYNSEATLKGCIESIYNCSYPTRL 85
gi 489644351   4 ANLIIQLGFWISWLLVPIIYEFIPAVVGFFSLLMAKRHLKNIKPLKEYPYITLIIPVYNSADTLFNCIKSIKDSSYPEHL 83
gi 499414199   5 NLALTRMGFWITWALVPIVVEIIPAIMSTIKLMRLHRHMPRLKAPAKWPWVTIIVPVYNSEDTLFDCIRSIDHQTYDKKS 84
gi 499268424   3 QQLIIQLLFWGIWLVIPLIVDIIGGVIGAIFITVSYFRKKKLD-IGYLPDITILIPIYNSENTLENCLNSVINQTYPIEK 81
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 499268486  86 IDVMLVDNQSSDNSFKIFTRCQKEFDGLSLRYMNSKQGKSKALNMALFNSSGKYIIHIDSDGKLHKDAIKNMVTRFEGNP 165
gi 499268475  86 IDLILVNNMSSDDSFQVFSQCQKEFCGLSMRYMNSKQGKSKALNMALFNSAGKYIIHIDSDGKLHYDAIKNMIVRFEKNP 165
gi 489644351  84 IKIIIADNQSTDESYQVYLHARNIFPDLYMNWINTDQGKAKALNAAIYKSIGKYVIHIDSDGILQHDALKNMVTDFENDP 163
gi 499414199  85 MQIILANNQSTDDSFGAYARAQNAFPNLFLRYVNTDKGKARALNAAIYESIGSYVINIDSDGLLEPNAIKNMVLRFENDE 164
gi 499268424  82 ISVMLINNGKRDKAYNVFCSFQERNPRLKVWWLDSSSGKAKALNKGIYMANGKYIINIDSDGVLDKEAILKVVEKFETNP 161
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 499268486 166 HVHCMTGVILTDKELIEKTKGSFFKLLRKCEFFEYAQAFLAGRNFESEVGSIYTLSGAFSAFRKSTILKTQLYNSETVSE 245
gi 499268475 166 NIHCMTGAILSDIEGIEKTHKRFLKLIRRCEFFEYAQAFLAGRNFESEINSIYTLSGAFSAFRKSTILKTQLYNSKTVCE 245
gi 489644351 164 SIDALTGTILTRKDLIKKTKNRFLKFVRENEYLEYSQSFLAGRAVESQDNHLFTMSGAFSAFRRDKLLHTNLYNIETVGE 243
gi 499414199 165 QIAAMTGAVLPQRNLVKQVHGWWHRLLAKNEYYEYAQAFLSGRTIESFRDQLFTMSGAFSAFRREVLMETFLYDTDTIGE 244
gi 499268424 162 DICAMTGVVLTDPELIEETKLKNLRLIQRCELFEYIEAFLIGRGFQSQVNMMFTLAGAFSCYRREIIMKTQLYNNETLGE 241
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 499268486 246 DTQITFQVKKLLNQKVYLCENALFFVDPIEGFNKLYTQRQRWQRGELEVSHMFLRDGLKFGKGFVSDFMVRTLMYDHTFA 325
gi 499268475 246 DTHITFQVRRLLKKKVYLCENSIFFVDPIENLNKLYTQRQRWQRGEIEVSHMFFKNKMNSPLGFFHNFMIRVVMYDHTFA 325
gi 489644351 244 DIDMTFQIRYQLHGKVILCPQAIFYVYPLDNLNKLYTQRQRWQRGELETLHMFFESRSIGISNIFSNFIVRRLIMDHTIL 323
gi 499414199 245 DTDMTFQIRTRLGKKVVICADAIFYVAPISGFSELYTQRQRWQRGELEVAQHYM-SQTASIKGFFKEFLVRRIMIDHTFT 323
gi 499268424 242 DTHMTSQIRELLDGKIALCEEAFFYVDPIDDLDKLYIQRQRWQRGQMEVSALFNEIANKNTKRFINVLKV-TIIKDHSLV 320
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 499268486 326 FPRMIWYFALIFLVFMNYPIYLVVGSVAVIYLLYSLSAFLFYLNVISYLKKYKEVRSYYAKKFYLIFLMPMYNFGVFWIR 405
gi 499268475 326 FPRMIWYFAIIFLFFMNYPVKLVVGSLVIIYMLYVLSTFLFYLNVRIYLKEYKSIREYYKARWGYIFLMPIYNFVVFWIR 405
gi 489644351 324 LLRVIWMFAYLFLIPLGYSVKVIGLSFVLLYFLYILISALNFINIQSFLKNFKSDRRYYLSKFYIIFSLPIYYFVCSFIQ 403
gi 499414199 324 FPRMIWTFATIVLIAFGYSTVVVGLSYLLIYSLYVMVGVINFISVGILLKPYPEERHFYKHLWWLTLTLPLYMFLTAWIR 403
gi 499268424 321 FPRFIWIFAMMYLVFLDYPLTLVVGANLILYIVYVITSTIYFFIAKLFLKEKKQIKDYVNKHWYIILLLPIYRFVVFFIR 400
                        410       420       430
                 ....*....|....*....|....*....|....*....
gi 499268486 406 FCGIINSIQLQGNWKTLNLTDEWRNFLGVFKRDFSVVFK 444
gi 499268475 406 FAGIINSIKIKSKWKTLTLNDEWTAFLKVIQSDFRMIGK 444
gi 489644351 404 VIGIINAMTTPAEWTTRNMTGEVKAFNNIVKRDFTRIFH 442
gi 499414199 404 LIGVINAMTTQATWKMRGFTEEWQRLLAVLRDDRRTIHN 442
gi 499268424 401 VAGIINAVEKNASWNTKTFSQEREIVDVRLKKNLSLYYR 439
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap