Conserved Protein Domain Family
cas5_csf3

?
TIGR03116: cas5_csf3 
CRISPR type IV/AFERR-associated protein Csf3
Members of this family show up near CRISPR repeats in Acidithiobacillus ferrooxidans ATCC 23270, Azoarcus sp. EbN1, and Rhodoferax ferrireducens DSM 15236. In the latter two species, the CRISPR/cas locus is found on a plasmid. This family is one of several characteristic of a type of CRISPR-associated (cas) gene cluster we designate Aferr after A. ferrooxidans, where it is both chromosomal and the only type of cas gene cluster found. The gene is designated csf3 (CRISPR/cas Subtype as in A. ferrooxidans protein 3), as it lies third closest to the repeats.
Statistics
?
PSSM-Id: 132160
View PSSM: TIGR03116
Aligned: 3 rows
Threshold Bit Score: 333.468
Threshold Setting Gi: 89885836
Created: 8-Oct-2014
Updated: 11-Oct-2014
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 499573869   4 PLKITFHLDTPM-QRSGYPIHLDALVAYAQTHAALagMDADNAPTGMLRELAE---DlpLAKTENNDEWVWKASALIPVS 79
gi 501633924   3 PLEIRFRLATPMlVHSDLPFHFDALMAYAVSRDSE--MNGSADPWLDAEDLSE---I--LGREGEGDSWVWQASRMEVLA 75
gi 499777969   3 PLRIEFKLVGPW-SPPAYGVHFDGLIAHAVVRDAL--RTASVSALGEERQYDHlicDlpFEKYESKAGWCWKASKLQVIG 79
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 499573869  80 FGEKSVRMWTRKTNPYDIARRIIaDKVEIGVRteNALKAGKPYAGAIDTARGLLKNMHEFYPVEEIHQLDAWCIGDIDLL 159
gi 501633924  76 RLPYPKIYESANNLRFTDPSRFY-DDLDRGLW--QPRGKVNPETFRIDPNSGQQRGYQMYLTTSNAQEVAFYVIGEEEAI 152
gi 499777969  80 FHGQQRRYLTAKT-PVNDMARAIgDGIV------EAKGGS-----IIDTVRGIGKNAALYYTLEHAEELHAWCIGDKEAL 147
                        170       180       190       200       210       220       230
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 499573869 160 ENLLAPesgwITHIGKRTRIGHGRVKTIQ------IEEDEEALEKWKLRVLP--WPEAG---YEPIQAGLRPPYW 223
gi 501633924 153 RFYLSQ----VTHLGKGSKNGYGRISNAE------IRDCPEAADRWRKRWLHkdMPGADgveYAPVMGRLRQPYW 217
gi 499777969 148 ESLLLE----IDGIGVKTRLGHGALAPFEdgrlfrVVADESATTRWKNRNAPdkLEDTM---YPGI-GSTHSPYW 214
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap