Conserved Protein Domain Family
citrate_citG

?
TIGR03125: citrate_citG 
triphosphoribosyl-dephospho-CoA synthase CitG
Triphosphoribosyl-dephospho-CoA is transferred to, and becomes the prosthetic group of, the respective acyl carrier protein subunits of both citrate lyase and malonate decarboxylase. Members of this protein family are triphosphoribosyl-dephospho-CoA synthases specifically from citrate lyase systems. This protein sometimes occurs as a fusion protein with CitX, the phosphoribosyl-dephospho-CoA transferase. [Biosynthesis of cofactors, prosthetic groups, and carriers, Other, Energy metabolism, Fermentation]
Statistics
?
PSSM-Id: 132169
View PSSM: TIGR03125
Aligned: 16 rows
Threshold Bit Score: 384.293
Threshold Setting Gi: 58337519
Created: 8-Oct-2014
Updated: 11-Oct-2014
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5921791    35 EQIAELAYQALIKEARLTPKPGLVDSTNNGSHQDMSLSTFEQSAIALRPFFTQFVLMGIETTNLPDSHILSKIRPLGLQA 114
gi 499783956  20 EAIGRLAERSLVLELELTPKPGLVDRANSGAHRDMDVGTFRASIAAISPWFSFFFERGVDGSAVPVEDFLRYIRADGMAC 99
gi 488192026   8 aSLSYLAVKSLLYELNLTPKPGLVDCHNNGAHNDMDFYTFLDSILSLSPFFKKYIEVGWLYHNESPQYLFNQLRKLGIEA 87
gi 499224783   7 TSISQLALKALLYEVSLSPKPGLVDRFDNGAHDDMSFITFIDSMIALSPFFQAYIETGFAYAKEEPLLLFNRLRQLGQKA 86
gi 445984579  19 DEYALLGWRAMLTEVNLSPKPGLVDRINCGAHKDMALEDFHRSALAIQGWLPRFIEFGACSAEMAPEAVLHGLRPIGMAC 98
gi 516010994  20 gELNGLVARALLTEARLTPKPGLVDIRNSGAHRDMDLAAFERSTTAIAPWMEKFFIMGNNTAALAAENVLVMLRPLGMAC 99
gi 499413789   4 KIIVNHALRALLYEVTVNPKPGLVDPLSAGPHPDMNAFMFIDSALSLAPYFNACAAAGVAYTAVDLTGLFKQIRGIGVQA 83
gi 499326618   6 KEVAKLATKALLYEVSISPKAGLVSRLSNGSHKDMDFYTFIDSVLSLSYYFSECYTYGQENNFYSP-NFFKNLRDLGKKA 84
gi 489643335   2 TQIVTNAIKALLYEVVTLPKPGLVDPSDIGPHPDMDVYMFINSSLSLREYFNKAEEIGITY-ETDLKKVFEQLRIQGRIA 80
gi 499694183   6 KAIAILAYQSLIAEVQLAPKPGLVDPESNGAHDDMDYPLFLKSIAALKAYLLAYIEAG--YQSTSDQQLFLTLRQIGQDA 83
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5921791   115 EQAMFVATNQVNTHKGAIFAFGLVCTALGRH-----FSRwqnkmmsSPSFEisqdttgISL----------ISETVARFT 179
gi 499783956 100 ERAMFAATLGVNTHKGSVFSFGLLCAAAGRL-----HGR-------GRPLS-------RAS----------VCAEVSHIC 150
gi 488192026  88 EAAMFSATERVNTHKGINFSFALLLGATGSY-----LAK-------HIELI-------QEKrrfmpqdsltICHLAGEMS 148
gi 499224783  87 EETMFCATQGINTHKGLNFSMALLLGATGAY-----LAR-------TPHLM-------TDLgrfskedtlaICRLVKPMT 147
gi 445984579  99 EGDMFRATAGVNTHKGSIFSLGLLCAAIGRL-----LQL-------NQLLT-------PTT----------VCSTAASFC 149
gi 516010994 100 ENDMLQATNGVNTHRGAIFAFGLLSAAIGRL-----LAR-------GEPLE-------QNR----------ICDQVARLS 150
gi 499413789  84 EQTMFAATKGVNTHKGAVFSLGVLVTAAAYQ-----LQ--------HPDVD-------LAT----------I---VRTML 130
gi 499326618  85 EKEMYQATNGVNTHKGTIFSMGILISVLASH-----LKE-------VDKID-------LKI----------LSQKIKNMC 135
gi 489643335  81 EKIMFHTTSGVNTHKGAIFSLGIFVCAES-------YAR-------FNNVD--------------------TFSVIRKMC 126
gi 499694183  84 EKQMLLATSQINTHKGANFSYALILGAIGRAsqtltLSE-------LVNLN-------FKP----------VFEIVRDMT 139
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5921791   180 QGITD-ELKNYSKNQP--LTAGITLYQQYGFTGARGEAEKGFPLVQQAV-VFIL-----SQAESEMRWYWALLYLMANNN 250
gi 499783956 151 AGLVKrEL--LLPAAA--RTAGELLYWQHGLTGARGEAQSGFATACAHGvVPYLla-raKGMDEERSLFEALLQLMAHNR 225
gi 488192026 149 MHLIQnDLSHVETKRN--LTYGEKLFLQYGLKGLRGEASQGYPSLTQKA-LPFFrnellKKQDIQISQLKLLLYLMTFIE 225
gi 499224783 148 AHLIQtDLGHLNTKKE--FTYGEQLFVTYGIKGPRGEASEGFTTLTDHA-LPYFrq-miSQNDPETSQLRLLVYLMSIVE 223
gi 445984579 150 RGLTDrELR--TNNSQ--LTAGQRLYQQLGLTGARGEAEAGYPLVINHA-LPHYltlldQGLDPELALLDTLLLLMAING 224
gi 516010994 151 RNIVAhELSAKK-AGK--LTKSETHFQCYGLSGARGEAESGFRTVRTQA-LPVFnrvvqEHDDTHLALLQTLLHLMAWND 226
gi 499413789 131 AGLTAnDFNDLNTKDPttLTAGERQYLTYGIKGIRGEAEAGYPTVMQVA-LPALr---rSRGTINQRLLDTLMAIVQATV 206
gi 499326618 136 SSLID-ELENINN--F--STYGEKAFKNYHLTGARGLALSGYDIVLLDG-INKLke-ftKSLDFETSCILLLFYYISLLD 208
gi 489643335 127 QGLVKnDLQ--KNNQN--LTAGEQQFIQYGQGGARQVAQEGYPIIEKIA-LPFLk---nRQGTTNQRLLDTLMKIATVIE 198
gi 499694183 140 KGLVSrDFSQIASKVQ--LSYGEQLYVEYGFTGIRGEAEAGYPSLEYVA-LPTLqk--yRMLPEDDRHLILMLTLMTEVQ 214
                        250       260       270       280       290       300       310
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|.
gi 5921791   251 DTNIVHR-GGINGLQFIQDEAHKRLGNAKNLQnaNALMASLREFDDDCIARNLSPGGSADLLALTIFFLSL 320
gi 499783956 226 DTNIVSR-GGMEGLCLVQAEARRLLDCPTPSR--SARTAQLAAFDQLLIERNLSPGGSADLLAVSWFLANL 293
gi 488192026 226 DSNIIHR-GGIKSWKKVQQEAQTLLEKDLPPY--Q-LKEQLNSYNQILTDRHLSPGGAADLLSLTLYFSFL 292
gi 499224783 224 DGNLIHR-GGIEAWKGVKADMRLLLQQDLS-T--TDLRLALSSYNQCLINQHLSPGGAADLLALTFYFAFL 290
gi 445984579 225 DTNVASR-GGEGGLRWLQREAQTLLQKGGIRT--PADLDYLRQFDRECIERNLSPGGSADLLILTWFLAQI 292
gi 516010994 227 DTNLVSR-GGLEGLYYVQQQAQKLLWQGGVLV--EGGIEAMQSLDDELILRNLSPGGSADLLAVTWFLSHF 294
gi 499413789 207 DTNLVKRaHDPHVIDWVHDQAHRYFDLGGSRS--EAGMAFLRELNQIFVDHNYSLGGSADLLILTIFIGLQ 275
gi 499326618 209 DTNIVNR-TNFETLKEIQILCKNLYEENVKSLskEKIRNEMSKLNDIFIEKNISAGGSADLLILTIFIHFI 278
gi 489643335 199 DSNLIKRaGNIEVINWLHQSAEKYLRLGGAET--KTGLAYLDELNKVFKENNYSLGGCADLLIVTIFMALe 267
gi 499694183 215 DMNLVHR-GGIDGWQMVQKAATVILQETDNML--L-VKRKLRQLDTELIEAHISPGGTADLLSLGIFFERL 281
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap