3F4W


Conserved Protein Domain Family
RuMP_HxlA

?
TIGR03128: RuMP_HxlA 
Click on image for an interactive view with Cn3D
3-hexulose-6-phosphate synthase
Members of this protein family are 3-hexulose-6-phosphate synthase (HPS), or the HPS domain of a fusion protein. This enzyme is part of the ribulose monophosphate (RuMP) pathway, which in one direction removes the toxic metabolite formaldehyde by assimilation into fructose-6-phosphate. In the other direction, in species lacking a complete pentose phosphate pathway, the RuMP pathway yields ribulose-5-phosphate, necessary for nucleotide biosynthesis, at the cost of also yielding formaldehyde. These latter species tend usually have a formaldehyde-activating enzyme to attach formaldehyde to the C1 carrier tetrahydromethanopterin. In these species, the enzyme is viewed as a lyase rather than a synthase and is called D-arabino 3-hexulose 6-phosphate formaldehyde lyase. Note that there is some overlap in specificity with the Escherichia coli enzyme 3-keto-L-gulonate 6-phosphate decarboxylase.
Statistics
?
PSSM-Id: 132172
View PSSM: TIGR03128
Aligned: 9 rows
Threshold Bit Score: 260.765
Threshold Setting Gi: 15920421
Created: 8-Oct-2014
Updated: 11-Oct-2014
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
3F4W_A         2 KLQLALDELTLPEAMVFMDKV-V-DDVDIIEVGTPFLIREGVNAIKAIKEKYPHKEVLADAKIMDGGHFESQLLFDAGAD 79
gi 499264551   5 LIQLALDSLDRDRTLELARVT-A-PYVDIFEIGTPCIKYNGIEIVRELKRRHPDRLVLVDLKTMDAGEYEAAPFYAAGAD 82
gi 499264838   5 LIQLALDTLDIPQTLKLASLT-A-PYVDIFEIGTPSIKHNGIALVKEFKKRFPNKLLLVDLKTMDAGEYEATPFFAAGAD 82
gi 499285122  13 NLQVALDFIDLKNAEEIAKQSiE-AGADILEVGTPLIKSYGIQGIRRIREIAKERIVLADTKTADAGDVEAEIVHLGGGN 91
gi 489339258   2 ELQLALDLVNIPEAIELVKEV-E-QYIDVVEIGTPVVINEGLRAVKEIKEAFPQLKVLADLKIMDAGGYEIMKASEAGAD 79
gi 446345006   2 ELQLAIDLLNKEDAAELANKV-K-DYVDIVEIGTPIIYNEGLPAVKHMADNISNVKVLADMKIMDAADYEVSQAIKFGAD 79
gi 499567407   2 KLQLALDRLDWETCFALVEDT-S-DAIDIIEIGTGVIKEYGMEIVRQMRKAFPRHTLLADMKICDAGKHEARQAFAAGAD 79
gi 499568647   2 ILQVALDLTDIEQAISIAEKA-ArGGAHWLEVGTPLIKKEGMRAVELMKRRFPDRKIVADLKTMDTGALEVEMAARHGAD 80
gi 500012815   2 KLQVAMDVLTVEAALELAGKV-A-EYVDIIELGTPLVKNAGLSAVTAVKTAHPDKIVFADMKTMDAGELEAEIAFGAGAD 79
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
3F4W_A        80 YVTVLGVTDVLTIQSCIRAAKEAGKQVVVDMICVDDLPARVRLLEEAGADMLAVHTGTDQQAAGRKPIDDLITMLKVRRK 159
gi 499264551  83 ICTVLGVSGPATIAGVVKAAQAHNAEVQVDLINVPDKAACAREAARLGAQIIGVHTGLDAQAQGQTPFADLESIARLKLP 162
gi 499264838  83 ITTVLGVAGLATIKGVINAANKHNAEVQVDLINVPDKAACARESAKAGAQIVGIHTGLDAQAAGQTPFADLQAIAKLGLP 162
gi 499285122  92 IMTVLGIMDDATIESAVKKAHEYGILVQADLINVKDILKRAEEIKRLGVDIIGLHVGLDVQKKRGITISDLKNEIKKVSE 171
gi 489339258  80 IITVLGATDDATIKGAVEEAKKQKKKILVDMINVKDIESRAKEIDALGVDYICVHTGYDLQAEGKNSFEELTTIKNTVKN 159
gi 446345006  80 VITILGVAEDASIKAAIEEAHKNNKQLLVDMIAVQDLEKRAKELDEMGADYIAVHTGYDLQAEGQSPLESLRTVKSVIKN 159
gi 499567407  80 IATVMAFAPAATIAETLSVASQEGKEMMVDLLGV-DKTEQVKALKEQGVSFVGLHLGKDEQQHKQLG----QGLFQLVEG 154
gi 499568647  81 VVSILGVADDKTIKDAVEVARRYGIRVMVDLIGVKDKVKRAKELEKMGVHYILVHTGIDEQAQGKNPLEDLEKVVKAVKV 160
gi 500012815  80 LVSVLGSADDSTIAGAVKAAKAHNKGIVVDLIGVADKVTRAKEARALGAKFIEFHAGLDEQAK---PGYNLNLLLSAGEE 156
                        170       180       190       200       210
                 ....*....|....*....|....*....|....*....|....*....|....
3F4W_A       160 A--R--I--AVAGGISSQTVKDYALLGPDVVIVGSAITHAADPAGEARKISQVL 207
gi 499264551 163 V--R--I--SVAGGINQNTASRVAKAGADIVVVGAAIYGAPCPATAARTIRELL 210
gi 499264838 163 V--R--I--SVAGGIKASTAQQVVKTGANIIVVGAAIYGAASPADAAREIYEQV 210
gi 499285122 172 L--GviV--SVAGGLNKNNIVDIIDLPINIYVVGGAITRAKNPLEEAKQIVKII 221
gi 489339258 160 A--K--T--AIAGGIKLDTLPEVIQQKPDLVIVGGGITSAADKAETASKMKQLI 207
gi 446345006 160 S--K--V--AVAGGIKPDTIKDIVAESPDLVIVGGGIANADDPVEAAKQCRAAI 207
gi 499567407 155 TglK--T--AIAGGVTVESLPVILPYRPDVIIVGSGVTKAEKPKEAAMHIKKRI 204
gi 499568647 161 P--V--A--V-AGGLNLDTIPKVIELGATIIIVGSAITKAKDPEEVTRRIIDLF 207
gi 500012815 157 A--R--VpfSVAGGVNLSTIEAVQRAGADVAVVGGSIYSAEDPALAAKQLRAAI 206
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap