Conserved Protein Domain Family
malonate_mdcH

?
TIGR03131: malonate_mdcH 
malonate decarboxylase, epsilon subunit
Members of this protein family are the epsilon subunit of malonate decarboxylase. This subunit has malonyl-CoA/dephospho-CoA acyltransferase activity. Malonate decarboxylase may be a soluble enzyme, or linked to membrane subunits and active as a sodium pump. The epsilon subunit is closely related to the malonyl CoA-acyl carrier protein (ACP) transacylase family described by TIGR00128, but acts on an ACP subunit of malonate decarboxylase that has an unusual coenzyme A derivative as its prothetic group.
Statistics
?
PSSM-Id: 132175
View PSSM: TIGR03131
Aligned: 12 rows
Threshold Bit Score: 241.833
Threshold Setting Gi: 53718974
Created: 8-Oct-2014
Updated: 11-Oct-2014
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 489203578   3 VLFAYPGQGAQRPGMLAAL---PDEPPVRACLEQAADCLGQAPAE-L---ESAEALRGTRAVQLCLLIAGVAASRLLETR 75
gi 499599679   3 LIILFSGQGLQSQRHIDEVlkvTNENDQSLLHTVIPELFANDSDN-I---FDNETLFDNRFAQPFIYTLQYYRWQQLRQL 78
gi 491065158   3 SIWVYPGQGAQKINMLHDL---PKHPLVDRYLEQASDVLNENIML-L---DQADSLKSTYSVQLCLYVAGVISSELLRLH 75
gi 506459708   3 ILFLFAGQGYHADSLFDIF---RTDKKTINYLKTMSSAAEIDF---L---QNNLEMTNPYSIQSIIGAYQLTLFSRLLPL 73
gi 499376410   3 SLLVFPGQGAQQPGMLQRL---PQSPQTRACLQEASDVLGQDVLT-L---DSPQALASTRAVQLCLLIAGVAAARTLLQP 75
gi 499794253   3 IAFLFPGQGSQRAGMLHEL---PAHPSVALTIDEASQVLGRNVLE-L---DEEKILESTVSTQVAIYVAGVAVARALAAE 75
gi 499620311   3 VLLTFPGQGSQRAGMLADL---PDHRAVAAVLAEAAEVLQTQPAD-M---DTASRLQSTVWVQLCLLTAGVAMARCLAAE 75
gi 499783409   3 YALVFSGQASQHPTMLPWL---DTDPMAADALHAMGLCLGANWRTaI---QDEGCRSNNAFAQVLITGTSLAAWAAVKDK 76
gi 499609001   3 LALLFSGQGGQTAAHWQQV---QAGATGEWREVLRQVLPGIADQDaM---VAPGILAKNKIAQPLIFAQQMLLWGSLQSR 76
gi 499362083   3 LALLCPGQGGQHAEMFARV---ADAPAAAAVFASAQRVLGVAPQA-L---AADPGRYANAIAQPLVCAGTLAHWQALCAQ 75
gi 489994998   4 PAFLYPGQGSQRAGMIAAL---PPTSATRRVLDEASDALG-GLGY-L---DTADGLASTRNAQLALLICGVAATRTLDEV 75
gi 490682210   3 IAILCSGQGGQHAGMFALT---ADLPEAAPLFAHAAALLGADPRE-WvrdADDEALRENFAAQLVCTLQAVAAMTRLDVL 78
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 489203578  76 GH-R-PGLVAGLSIGAYPAAVVAGALDFDDALRLVALRGELMQAAW-PE----GYGMSAILG-LEQAQLEALILAV---- 143
gi 499599679  79 LE-K-PSAFAGYSLGEINAFCCSSQLDFEVGLTLINHRAKFMEEGV-SE----SSGLLAIQG-LHNSELENLLLKT---- 146
gi 491065158  76 GV-K-PKFVAGLSIGAWAAATVAHVIRFEDGLKLVAKRAQLMQQAY-PK----GYGMTAILG-ADCSQIEQWIEQTqqnq 147
gi 506459708  74 FTnH-QVDLAGYSLGEISAFLGSINANPRDSFKLFRYRTQLMTSIV-DNnifaEYDLLSVVGkFILEEIQPVIAKH---- 147
gi 499376410  76 DT-R-VNYVAGLSIGAYPAAVVAGALEFADALRLVSLRGELMQQAY-PQ----GYGMTALIG-LELAAVEGLLAQV---- 143
gi 499794253  76 GA-L-PSAVAGLSVGAYAAATACGALAFPDGLRLVHLRASLMEQQF-TT----GYGLAAIVG-LDEEQVTALVAKA---- 143
gi 499620311  76 GG-H-ADAVAGLSIGAYAAAVSAEVLPFSDALRIVRLRGELMEQAY-PN----GYGMTAILG-LERMRLEPLVAQI---- 143
gi 499783409  77 LP-QaPAVVAGYSVGELSAFACAGVFSTDQAIALAAQRAALMDQAV-SGl---HTGLLAVSG-ISEGRVLAVSAGL---- 146
gi 499609001  77 LP-R-PICAAGYSLGEMAACSAASAFTAIEGIALCVERAAAMDGAA-AG----EHGMLAVLG-LDDALVATMAAEA---- 144
gi 499362083  76 LP-T-PLLVLGYSVGELAAHAVAGSMSIDTCLQLAATRARLMDAAS-PQ----QAGLMAVIG-VPLRALETLCQTH---- 143
gi 489994998  76 YGvR-PGVTAGHSAGAFAAAVAAGVLTFHEALDAVGVRAAAMEAACaPG----EWGMAAVTG-MGQRAAGALVAEA---- 145
gi 490682210  79 LP-R-RRCVAGYSVGELAAWSVAGLVEARDALDLVAARARAMDAAS-DG----DARMLFVRG-LARDAVDASCAAH---- 146
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 489203578 144 RrehppLYLANVNAERQLVVAGSEAALAALAERARAAGASAAKRLAVSVPSHCALLDEPAARLAEAFAG-IRLHR---PR 219
gi 499599679 147 D-----THLSIKINEDQFIIGGHRDNLSQADTLAQSLGARNTQLLKVTVPSHTKMMQKAAEKFCEYIDS-ITLPA---MQ 217
gi 491065158 148 Q-----VFIANLNTENQVVISGSEQAMQYVIHHAQQNGA-IAKKVEISVPSHCVLLEKQAHQLAGFMEE-IPTQQ---PT 217
gi 506459708 148 N-----CYIAIINSAQHVVIGGKISDLRHLITELSQYPISHAKFLGVYLPSHTDFYSDKSKQFQRFLDEnYGFYS---LK 219
gi 499376410 144 HssqrpVYLANINADNQVVIAGSDAAMHAVAELARGCGVGVAKRLAVSVPSHCPLLEQPAQALAAAFAE-VPLQL---PK 219
gi 499794253 144 TteqfpVYVGNLNAPRQIVVAGALPGVDRVVELAIATGCKKAERLAVRVPSHCPLLQGVADVLLDKLKT-LEPGT---VR 219
gi 499620311 144 HtpqtpVYLANFNAPAQIVIAGSVPAMEAVAALAIASGAQAAKRVAIHVPSHCALLDDAAAELGKEMAH-IAMSP---PR 219
gi 499783409 147 G-----LECAIRVNPSQAVFAGTDDALSQAALALGAA-GAVCKRLDVRVASHSSWMAQAAHAFSDVLSA-LPFAA---PF 216
gi 499609001 145 G-----LAVAIRNAPRHLVVAGPLAGIVAVADKFAAAGASRLVHLAVQTPSHTPLLAKAAVEFGKRLDG-LPDRR---LA 215
gi 499362083 144 G-----AALAIINGDDHAVLGGPRAALQALGEAASAQGA-RVTLLPVGVPAHTPWLSAAAEGFAIELAT-AQLAA---PR 213
gi 489994998 146 Ra---tVWIANINAADQVVLGGTVDGLRDARAAARRMGARRFEMLDVAVASHGPVQARTATVIAERLAA-VPRRH---QS 218
gi 490682210 147 G-----AAVAIVNPGDAYVLAGPRAALDALAADARARGAARVTPVCVRVASHTHWLDAAVPRFRAALAG-ARIARapaPG 220
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 489203578 220 VPYLSSSRARLV-AEPAALADDLAGNMARRVEWLATLRSAYERGARLHLELPPGRVLSGLARPLFGCAt--PAFEGSRAD 296
gi 499599679 218 IPIISATNGMKY-NDTNQGLNILSSQIDHPLDWYFCMENIEEYQPSMIIEIGPGNALSKMINNLLPHV---PCRSWDDFR 293
gi 491065158 218 IQYLSGTSARLL-RTNTQIMNDLAFNMSRMIDWHNTVQAAWERGARLQIEALPGTVLTSLARKIFKEG---TLLSFQNT- 292
gi 506459708 220 YPVISPLELNKI-YNAKQERALLAQELYTTLQWHKVCDLIGEYQYNLIIDLGPGDSMTTILNKANTELfntPLIIASHYN 298
gi 499376410 220 LGYLSGSRARPM-RSVEALRDDLAFNMCRVVDWRGTVQSAYERGVRLQIELPPGAVLTGLARRVFAQG---TVIAFDGAR 295
gi 499794253 220 AQYMTNRRARPT-RVLDRIREDVATNIAHPVRWHDSTEILVGLGTTLFVEINPGQVLSKLTTEAFPQV---PSIAMVAMP 295
gi 499620311 220 LRYFSASLAREL-RDPRRIADDLALNMAVPVRWHETMLLAYATGARVVIEAPPGDVLTRLAQPVFADG---IVMAADRTR 295
gi 499783409 217 CPIATNAYGVLS-RQPAELRQALGQQLACTVRWSSCMEALAERQVSCVLEIGAGSALARMWNERYPDI---PARSLDEFQ 292
gi 499609001 216 FPVLSAIDATAA-RTARPALDALARQICTPLDWAACLQAVREMQPDAVLEIGPGNALAKLFGELVPTI---PVRACDDFR 291
gi 499362083 214 LRVLAGIDARAV-GTQALVVDTLSRQIAQTVRWYDVLVQAAERGARVFLELGPGSALARMAREVLPAC---EARSVDEFH 289
gi 489994998 219 AAYLTNVGARRIvDDADAVLRDLAESVAKPVQWYDIAQVLPELGVQRTVEMPPGHVLTSL-------L---AAVPVTATS 288
gi 490682210 221 TRLLSGIDGAPV-LDVAAGADKLARQIAEPLDWAACVAGCVEAGARAFVELGPGRALAEMAAAAFPAL---PARSLADFR 296

                 ....*..
gi 489203578 297 TLDALLR 303
gi 499599679 294 HADGLLE 300
gi 491065158 293 SIETLII 299
gi 506459708 299 SLKGLCN 305
gi 499376410 296 -LDTLQA 301
gi 499794253 296 -FDYAVR 301
gi 499620311 296 -VDSLAA 301
gi 499783409 293 GPKGAAQ 299
gi 499609001 292 SVEGIVR 298
gi 499362083 290 STDGVLE 296
gi 489994998 289 VDDVGYA 295
gi 490682210 297 SWDGVRA 303
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap