3BO9


Conserved Protein Domain Family
enACPred_II

?
TIGR03151: enACPred_II 
Click on image for an interactive view with Cn3D
putative enoyl-[acyl-carrier-protein] reductase II
This oxidoreductase of the 2-nitropropane dioxygenase family (pfam03060) is commonly found in apparent operons with genes involved in fatty acid biosynthesis. Furthermore, this genomic context generally includes the fabG 3-oxoacyl-[ACP] reductase and lacks the fabI enoyl-[ACP] reductase.
Statistics
?
PSSM-Id: 132195
View PSSM: TIGR03151
Aligned: 8 rows
Threshold Bit Score: 448.044
Threshold Setting Gi: 163931227
Created: 8-Oct-2014
Updated: 11-Oct-2014
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
3BO9_A        16 RTRVTDLLEIEHPILXGGXAWAGTPTLAAAVSEAGGLGIIGSGAXKPDDLRKAISELRQKTDKPFGVNIILVSPWADDLV 95
gi 499410985  10 ENAFCNMIGLDYPIIQGAMAWIANSSLASAVSNAGGLGIIASGNQPVDIVKEEIRKTKELTNKPFGVNIMLLSDNAEELA 89
gi 499779768   3 KTKLCDLIGIEYPVFQGGMAWTATGELAAAVSEAGGLGIIGAGQAPADWLRQEIHKIKKVTNKPYGVNVMLMSPFVEDVM 82
gi 499663622   2 KTKITELLKIKYPIIQGGMAWVATARLAAAVSNAGGLGIIGAGNAPAEWVLAEVRKVKNLTDKPFGVNVMLLSPHVDEVM 81
gi 446780211   2 KTRITELLNIKYPIFQGGMAWVADGDLAGAVSKAGGLGIIGGGNAPKEVVKANIDKIKSMTDKPFGVNIMLLSPFVDDIV 81
gi 568335160   2 RTRVTDLLEIEHPILMGGMAWAGTPTLAAAVSEAGGLGIIGSGAMKPDDLRKAISELRQKTDKPFGVNIILVSPWADDLV 81
gi 499711728   3 RTPLCDLLGITYPIIQGGMAWVATGELAAAVSAAGGLGIIGAGSAPPDVVRREIRKVREQTDRPFGVNIYYLSPYVEELV 82
gi 227176596  16 NQELCELLGINYPIFQGGMAWVADASLASAVSNAGGLGIIAGGNAPKEVVKKEIKKVKELTEQPFGVNIMLLSPFADEIV 95
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
3BO9_A        96 KVCIEEKVPVVTFGAGNPTKYIRELKENGTKVIPVVASDSLARXVERAGADAVIAEGXESGGHIGEVTTFVLVNKVSRSV 175
gi 499410985  90 KLICEENIKVVTTGAGNPGKYIDMWKKSGVKVIPVVASVALAKRMERAGADALIVEGCEAGGHIGELTTMALLPQVVDAV 169
gi 499779768  83 QVIVEERVPVITTGAGNPGKYIPMLKEVGTKIIPVVASVALARRLEKAGVDALIAEGMESGGHIGEISTLPLVPQVVDAV 162
gi 499663622  82 EVIIEEKVPVITTGAGNPGKYIKKLKENNVKIIPVVASVALAKRLEKTGVDAVIAEGHESGGHIGELTTMALVPQVVDNV 161
gi 446780211  82 DLVIEEGVKVVTTGAGNPGKYMERFHEAGITVIPVVPSVALAKRMEKLGADAIITEGMEAGGHIGKLTTMTLVRQVVDAV 161
gi 568335160  82 KVCIEEKVPVVTFGAGNPTKYIRELKENGTKVIPVVASDSLARMVERAGADAVIAEGMESGGHIGEVTTFVLVNKVSRSV 161
gi 499711728  83 DLVCEERVPVVTTGAGNPGKHLPRFKEAGVKVIPVVASVALAKRLERLGVDALVAEGMECGGHIGEIATMPLVPQIVDAV 162
gi 227176596  96 DLVCEEQVPVVTTGAGNPAKYMARFKEHNIKVIPVVPSVALAKRMEKIGADAVIFEGMEAGGHIGKLTTMSGLPQIVDAV 175
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
3BO9_A       176 NIPVIAAGGIADGRGXAAAFALGAEAVQXGTRFVASVESDVHPVYKEKIVKASIRDTVVTGAKLGHPARVLRTPFARKIQ 255
gi 499410985 170 NIPVIAAGGIGDKRGVLATFALGAIAVQVGTRFLVAKECNIHRNYKEKVLKAKDIDTVVTGRNTGHPVRVLRNRLTRKYQ 249
gi 499779768 163 SIPVIAAGGIYDGRGMVAALALGAEGVQMGTRFMCAEECTISSKVKEMILKAKDRDTVVTGRSTGHPVRCLGNKLTREFE 242
gi 499663622 162 SIPVVAAGGIADGRGLVAALALGAQAVQIGTRFLCAEETEIHPAVKEAVIKAGDRDTVITGASTGHPVRVIKNKLARRFL 241
gi 446780211 162 TIPVIAAGGIADGRGAAAGFMLGADAVQVGTRFVVAKESNAHPNYKAKILKAKDIDTAVSAQVVGHPVRALKNKLVTTYS 241
gi 568335160 162 NIPVIAAGGIADGRGMAAAFALGAEAVQMGTRFVASVESDVHPVYKEKIVKASIRDTVVTGAKLGHPARVLRTPFARKIQ 241
gi 499711728 163 HIPVIAAGGIADGRGLAAALALGAAGIQMGTRFICATECTVHANYKEAVLKAGDRDAVVTG-MAGHYVRVLKNKLTRQFE 241
gi 227176596 176 SIPVIAAGGIGDGRGMAAAFMLGAEAVQLGTRFLIAKECNVHPDYKQKVLKARDLDAVITCQHFGHPVRTLKNKLTAQYN 255
                        250       260       270       280       290       300       310
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*.
3BO9_A       256 EXE-----F----E--NPXQAEEXLVGSLRRAVVEGDLERGSFXVGQSAGLIDEIKPVKQIIEDILkEFKETVEKL 320
gi 499410985 250 ILE-----K----EnaPMEEFEKITKGALIKAVKEGDIQTGSLMAGQIAGLISKEQSCKEIIKEMF-DFKEVIKRL 315
gi 499779768 243 QLE-----K----EgtDPEVLEKMGAGKLRLAMVEGDTQNGSVMSGQIAGAVQKIEPAATIIQDVMqGSERELARL 309
gi 499663622 242 ELE-----Q----KgaPPEELEKLGAGSLRRCMQEGDIEEGSLMAGQIAGLIKEIKPVKEIIEEIMhEAREIMKRI 308
gi 446780211 242 QAE-----KdylaGriSINEIEELGAGALRNAVVDGDVINGSVMAGQIAGLIKSEETCQEILEDIYsGARQVILSE 312
gi 568335160 242 EME-----F----E--NPMQAEEMLVGSLRRAVVEGDLERGSFMVGQSAGLIDEIKPVKQIIEDILkEFKETVEKL 306
gi 499711728 242 ELS-----A----RgaSWEEMDRLGTGKLRAAAVDGDVEYGSVMAGQSAAMVREIKPAAAIIAEIMaEAAEVIARL 308
gi 227176596 256 QLEkqelqK----EvpDLEMFEKIGQGALRKAVVDGDMDYGSVMAGQIAGLIKKEETAQEIIDSLMsECKAIVHKM 327
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap