Conserved Protein Domain Family
alt_F1F0_F1_eps

?
TIGR03166: alt_F1F0_F1_eps 
alternate F1F0 ATPase, F1 subunit epsilon
A small number of taxonomically diverse prokaryotic species have what appears to be a second ATP synthase, in addition to the normal F1F0 ATPase in bacteria and A1A0 ATPase in archaea. These enzymes use ion gradients to synthesize ATP, and in principle may run in either direction. This model represents the F1 epsilon subunit of this apparent second ATP synthase.
Statistics
?
PSSM-Id: 132210
View PSSM: TIGR03166
Aligned: 8 rows
Threshold Bit Score: 155.972
Threshold Setting Gi: 53717630
Created: 8-Oct-2014
Updated: 11-Oct-2014
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 499572897   2 KLRIITPLMVVLDEPDVMSLRAEDESGSFGILQGHADLVSSVLPSVVIWKRRDGTPHYCAVRQGVLtvTEKGHMVEIATR 81
gi 499235170   2 RLKILLPYRVFAIKERVLNIVAETELGSYGFLPNRLDCIAPLVPGILMYKTHDEGETFVAVDQGIL--VKTGPEVVVSVR 79
gi 499331919   7 NLKILLPFQVFAEKKGVSRIVAETREGSFGLLPHRLDCVAALEPGIFIYETEAEGEVYVAVDEGIL--IKAGKDVLVSVR 84
gi 499677064   2 RLELLLPFGVFSVTEKVTRIVAETNCGSWGFLPGRRDCVASLVPGILEYETLESGVSFVAVDCGIL--VKKGSDVVVSVR 79
gi 499700247   2 DLKILLPFSVFMEKARVDRIVVETVDGSLGLLPHRLDCVAALVPGILIFETRSEGEIYVAVDEGIL--VKVSAQVTVSVR 79
gi 499432702   2 NLTLNTPNEIVLN-LTVNKVVAEGTHGSFCLLPRHVDFLAALVPGLLSWVDETGKESFAAVGNGIL--VKRANDVYVSAE 78
gi 499662044   2 RLRVQTPAERILD-CPVTKVVAEGLNGSFCLRPRHVDLVSAVVPGLFYYETAEGQGHYIALDRGLL--VKRETLVSVSVR 78
gi 686867404   6 RVTIATPARVCVDDLPIVSLRAEDASGAFGIRAGHVDFVTLLRASVVRWRTADGATHYAALDGGVLr-VTRGARIEIACR 84
                         90       100       110       120
                 ....*....|....*....|....*....|....*....|....
gi 499572897  82 EAVCGDDLETLKTLVRQHYAALDDARRNANVASVRLQLDAVRRI 125
gi 499235170  80 HAIGGVDLGQLESAVKQQFLDLDERERSVRSTMAKLESSFIRRY 123
gi 499331919  85 SAIVGTDLSQLREAVEREFLTLDESEKKIRSVMTKLEIGLMRRL 128
gi 499677064  80 QAVGGVELGALEKAVKEDFLELDEHERTMHSALARLESSFIRRY 123
gi 499700247  80 NAVEGTNLAVLHETVDREFLNLDERAKSIRRTMAKMESGLIRRF 123
gi 499432702  79 AASHGTELEELRRLVREEFSQMDEQQRAAHTAVARLEADFLRRT 122
gi 499662044  79 NAVAAGELEDLLEVVQLRFKALDEQERVVRSAVARLESDFLRRF 122
gi 686867404  85 DAVLGESLAELEAVVRGVRATQLDEKRRARVDETRLHAQAVRRL 128
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap