Conserved Protein Domain Family
benz_CoA_bzdN

?
TIGR03190: benz_CoA_bzdN 
benzoyl-CoA reductase, bzd-type, N subunit
Members of this family are the N subunit of one of two related types of four-subunit ATP-dependent benzoyl-CoA reductase. This enzyme system catalyzes the dearomatization of benzoyl-CoA, a common intermediate in pathways for the degradation for a number of different aromatic compounds, such as phenol and toluene.
Statistics
?
PSSM-Id: 132234
View PSSM: TIGR03190
Aligned: 3 rows
Threshold Bit Score: 826.204
Threshold Setting Gi: 56475815
Created: 8-Oct-2014
Updated: 11-Oct-2014
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 45649067    3 DGLFDQFKTWYEKRHDYARDWKVRTGGQVVATMCTYTPEELLIAAGMLPVRVLGAHEPQNVTEPHIFGMFCPFCRDSLAQ 82
gi 499558020   3 DGLFDQFKTWYEKRHDYARDWKARTGGQVVATMCTYTAEELLIAAGMLPVRVLGAHEPQNVTEPHIFGMFCPFCRDSLAQ 82
gi 499555455   3 DGLFDQFKEWYEKRHDYARAWKARTGGQVVATMCTYSPEELLIAFGMLPVRVLGAHEPQNVTEPHIFGMFCPFCRDSLAQ 82
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 45649067   83 GLLGRFDYAEGVTLTQSCIQYRQTFGSWRLHVPTVKWDYYVPMPNEVQSPHARKAHYEEVQAFRVFLQTLTGKEITDAML 162
gi 499558020  83 GLLGRFDYAEGVTLTQSCIQYRQTFGSWRQHVPTVKWDYYVPMPNEVQSEHARKAHYAEIQSFRVFLQTLIGKEITDDML 162
gi 499555455  83 GLLGRYDYAEGVTLTQSCIQYRQTYSSWRQNVPTVKWDYYVAMPNDVQSPHARKAHVAEVQRFRVFLQTLTGKEITDDML 162
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 45649067  163 SDALAVCDENRRLLRELYEYRKAADPKVTGVEALYASLTAQFIDKREHNEMLKKTLAALPNRKVERKTGARFMTIGSEND 242
gi 499558020 163 RESLAVVDENRRLLRELFDYRKDANPKVTGVEAVYASLTAQFIDKREHNEMLKKVLAALPSRKVERQTGARFMTIGSEND 242
gi 499555455 163 RDALAVCDENRRLLRQLFDYRKEADPKVTGVEALYASITAQFIDKREHNEQLKKVLAALPSRKVERKTGARFMTIGSEND 242
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 45649067  243 DIAFMGMVESVGATIVIDDQCSGSRYFWNASKPEGDVIKAIAERYCDRPACPTKDYPAHTRFDHVLGMAKEYNVEGAIFL 322
gi 499558020 243 DIAFMAMVESVGATIVIDDQCSGTRYFWNESKPETDVIKAIADRYCDRPACPTKDYPVHTRYDHVLGLAKDYGVQGAIFL 322
gi 499555455 243 DVAFMAMVESVGATIVIDDQCSGTRYFWNASKPGDDVIRAIAERYCDRPACPTKDYPVHTRYDHVLNLAKEYNVQGAIFL 322
                        330       340       350       360       370
                 ....*....|....*....|....*....|....*....|....*....|....*..
gi 45649067  323 QQKFCDPHEGDYPDLKRHLEENGIPTLFLEFDITNPIGPFRIRIEAFLETLSEEELF 379
gi 499558020 323 QQKFCDPHEGDYPDLKRHLEANGIPTLFLEFDITNPIGPFRIRIEAFLETLSEEELF 379
gi 499555455 323 QQKFCDPHEGDYPDLKRHLEANGVPTLFLEFDITNPIGPFRIRIEAMLETLSEEELF 379
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap