Conserved Protein Domain Family
benz_CoA_bzdO

?
TIGR03191: benz_CoA_bzdO 
benzoyl-CoA reductase, bzd-type, O subunit
Members of this family are the O subunit of one of two related types of four-subunit ATP-dependent benzoyl-CoA reductase. This enzyme system catalyzes the dearomatization of benzoyl-CoA, a common intermediate in pathways for the degradation for a number of different aromatic compounds, such as phenol and toluene.
Statistics
?
PSSM-Id: 132235
View PSSM: TIGR03191
Aligned: 2 rows
Threshold Bit Score: 971.018
Threshold Setting Gi: 56478437
Created: 8-Oct-2014
Updated: 11-Oct-2014
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 499558021   8 YPTEPLKLWGKAKQLREQYYQNYARAKEKGGIRWSGSAWALDAIPAGLGEDVYSLTGEPYAAAVAHDRKFAKECMDAAEA 87
gi 499555454   5 YPTEPLKLWGKAKQLREQYYQNFARAKDNGGIRWSAAGWSFDAIPTSLGDDVYPLTGEPYSAGVSLDRKFTQRCLDAAES 84
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 499558021  88 YGFARDLCSYMRIYWGGMHLNKYAFGGEFPKPDFVFQTQICCSHSKWYQHVAKEEKVPEFYLDVGVGPYRDMTDARLDYV 167
gi 499555454  85 YGFARDMCSYMRIYWGSMHLDEYFYGGKWPTSDFIFQTQICCSHAKWYQHVSRTKKIPDFYVDVSVGAYKDLTSDSLDYV 164
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 499558021 168 ANQLHDGIEFVEKASGRKFDDELFIKAVKNEMRSTSRWADICALNKVKPAPLDEKTMYSLYVLCTLQKSSQWCADFMDEL 247
gi 499555454 165 TSQLHDSIEFVEKATGRKCDDELLIRAIKNEMRSTARWAQICELQKAVPAPLDEKTMYSLYVLAILHKSSQWCADFYDEL 244
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 499558021 248 YEEVKDRVARGIAAVPNESVRLMTDTQPPWSFLKIFRYLETYGAVSIGSLYTFALEGIWEDKPDGSWGGRTLPWEKGIEI 327
gi 499555454 245 YEEVKDRVARGIAAVPNERCRLMSDTQPPWPFLKIFRYLETYGAVSIGSLYTFGLEGTWEYKEDGSWGARTLPWEKGIEM 324
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 499558021 328 NDRATAVRLYADWNLSKPQWQHFYDPRIKSEMMLRIIREWQVDGVMLHLNRGCEGLSIGIMENRLAIAKAGIPVMTFEGN 407
gi 499555454 325 NDRDTALRLYADWNLSKPLWQQFFDPSVKSEMMLNIARDWNVDGCMMHLNRGCEGLSVGIMENRQAIAKAGIPIMTYEGN 404
                        410       420       430
                 ....*....|....*....|....*....|
gi 499558021 408 MGDEREFDEVRTQARVDAFMEQLGMRRQAA 437
gi 499555454 405 MGDEREFDEVRTQARVDAFMEQLGLRRLAA 434
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap