Conserved Protein Domain Family
pucE

?
TIGR03198: pucE 
xanthine dehydrogenase E subunit
This gene has been characterized in B. subtilis as the Iron-sulfur cluster binding-subunit of xanthine dehydrogenase (pucE), acting in conjunction with pucC, the FAD-binding subunit and pucD, the molybdopterin binding subunit. The more common XDH complex (GenProp0640) includes the xdhA gene as the Fe-S cluster binding component.
Statistics
?
PSSM-Id: 132242
View PSSM: TIGR03198
Aligned: 3 rows
Threshold Bit Score: 262.094
Threshold Setting Gi: 56965500
Created: 8-Oct-2014
Updated: 11-Oct-2014
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 499567793  10 KVSLTFQINGQTRQVETYASVRLADVLREELGLTGTKVSCGIGRCGACAVLMDGKVVNSCLLMAFQATNVELQTIEGIta 89
gi 499199382  15 KAPTNFFLNGVETKLTHDPAKRLIDLLRDDLTLTGTKRSCEIGRCGGCMVLVDGKAHNACLMMAYQCEGKEVVTIEGI-- 92
gi 489336055  13 KEQFRMTVNGQAWEVAAVPTTHLSDLLRKEFQLTGTKVSCGIGRCGACSILIDGKLANACMTMAYQADGHSITTIEGL-- 90
                         90       100       110       120       130       140       150
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....
gi 499567793  90 sAENGVDPVQQAFLEEGGFQCGYCTPGMVVAAKALLNENQAPSDEEMAEALSGNLCRCTGYAGIIRAVRKAAKG 163
gi 499199382  93 -AENELDPIQKAFLEEGGFQCGYCTPGMVVSLKAVFMEHEKPTFEQMKQGLSGNLCRCTGYGGIIRVLKHLCDG 165
gi 489336055  91 -QKEELDMCQTAFLEEGGFQCGYCTPGMIIALKALFRETPQPSDKDIEEGLAGNLCRCTGYGGIMRSACRIRRE 163
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap