Conserved Protein Domain Family
dearomat_oah

?
TIGR03200: dearomat_oah 
6-oxocyclohex-1-ene-1-carbonyl-CoA hydrolase
Members of this protein family are 6-oxocyclohex-1-ene-1-carbonyl-CoA hydrolase, a ring-hydrolyzing enzyme in the anaerobic metabolism of aromatic enzymes by way of benzoyl-CoA, as seen in Thauera aromatica, Geobacter metallireducens, and Azoarcus sp. Note that Rhodopseudomonas palustris uses a different pathway to perform a similar degradation of benzoyl-CoA to 3-hydroxpimelyl-CoA.
Statistics
?
PSSM-Id: 132244
View PSSM: TIGR03200
Aligned: 4 rows
Threshold Bit Score: 655.441
Threshold Setting Gi: 56478447
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 3724166    17 LVDHNLV----PETVCPGVL-YEKRPARNLKGEVVPGLYNVWISLDNPKQYNSYTTDMVKGLILAFRAASCARDVASVVF 91
gi 490649583  16 LNDHNLIdr-eVESLCDGMVkYEKRPAKRHDGSVAEGIYNAWIILDNPKQYNSYTTDMVKAIILAFRRASVDRSVNAVVF 94
gi 499703808  17 LNDHNLV----PTTVVPGVL-YEKRPAKRADGTVAEGLYNAWITLDNQKQYNSYTTDMVKGVIMAFRDASNARDVSSVVF 91
gi 499558029  12 IKDHALMgeehFGTEAPSVL-FEKRPVTDPQGNVVPGLYAAWIILNNPKQYNSYTTEMVKAIIAGFQRASSDRTIVAAVF 90
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 3724166    92 TAVGDKAFCTGGNTKEYAEYYAGNPQEYRQYMRLFNDMVSAILGCDKPVICRVNGMRIGGGQEIGMAADFTVAQDLANFG 171
gi 490649583  95 TGVGDKAFCTGGNTKEYAEYYAGNPQEYRQYMRLFNDMVSAILGCDKAVISRVNGMRIGGGQEIGMACDFSIAQDLANFG 174
gi 499703808  92 TGAGDKAFCTGGNTKEYAEYYAGNPQEYRQYMRLFNDMVSAILGCDKPVICRVNGMRIGGGQEIGMAADFSVAQDLAKFG 171
gi 499558029  91 TAVGDKAFCTGGNTAEYASYYAQRPNEYGEYMDLFNAMVDGILNCKKPTICRVNGMRVGGGQEIGMATDLTITSDMAIFG 170
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 3724166   172 QAGPKHGSAAIGGATDFLPLMIGCEQAMVSGTLCEPFSAHKANRLGICMQIVPALKVDGKFIANPLVVTDRYLDEFGRII 251
gi 490649583 175 QAGPKHGSAAIGGATDFLPLMVGCEQAMVSGTLCEPFSAHKAARLGIICDVVPALKVGGKFVANPTVVTDRYLDEYGRVV 254
gi 499703808 172 QAGPKHGSAPIGGATDFLPVMIGCEQAMVSGSLCEPWSAHKAYRTGIIMDLVPALKVDGKFVANPLVITDRYLDEFGKIV 251
gi 499558029 171 QAGPKHGSAPDGGSTDFLPWMLNMEDAMYNCISCEPWSAYKMKSKNLITKVVPVLKKDGEWVRNPLVRTDAYVDD-GELV 249
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 3724166   252 HGEFKTGDELAAGKELMKRGEIDLSLLDEAVEKLCAKLISTFPECLTKSFEELRKPKLDAWNRNKENSRAWLALNMMNEA 331
gi 490649583 255 HGEFKAGAAFKEGQGQIKEGEIDLSLLDEKVESLCTKLLETFPECMTKSLEELRKPKLHAWNLNKENSRAWLALNMMNEA 334
gi 499703808 252 HGESKTGAELAAGKELLKKGTIDLSLLDAKVEEICAKILHTFPDCFTKTIQELRKPKLNAWNANKENSRDWLGLNMMTEA 331
gi 499558029 250 YGEPVAADKAKAAKELIAQCTTDFAKLDEAVDALVWKFANLFPQCLIKSIDGIRGKKKFFWDQMKLANRHWLAANMNHEA 329
                        330       340       350       360
                 ....*....|....*....|....*....|....*....|...
gi 3724166   332 RTGFRAFNEGNKETGRE-IEFTDLRQALAKGMPWTPELIESLM 373
gi 490649583 335 RTGFRAFNEGTKETGRE-IDFVKLRQGLAKGTPWTEELIESLM 376
gi 499703808 332 RTGFRAFNEGPKE-DRE-IDFVALRQALAKGAPWTPELIESLI 372
gi 499558029 330 YLGFTAFNN-KKATGKDvIDFIKFRQLVAEGHAFDDAFAEQVL 371
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap