Conserved Protein Domain Family
dearomat_had

?
TIGR03201: dearomat_had 
6-hydroxycyclohex-1-ene-1-carbonyl-CoA dehydrogenase
Members of this protein family are 6-hydroxycyclohex-1-ene-1-carbonyl-CoA dehydrogenase, an enzyme in the anaerobic metabolism of aromatic enzymes by way of benzoyl-CoA, as seen in Thauera aromatica, Geobacter metallireducens, and Azoarcus sp. The experimentally characterized form from T. aromatica uses only NAD+, not NADP+. Note that Rhodopseudomonas palustris uses a different pathway to perform a similar degradation of benzoyl-CoA to 3-hydroxpimelyl-CoA.
Statistics
?
PSSM-Id: 132245
View PSSM: TIGR03201
Aligned: 3 rows
Threshold Bit Score: 581.477
Threshold Setting Gi: 19571180
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 19571180   20 RWMMTSPGAPMVRAEFEIGELSADQVVVAVAGCGVCHTDLGYYYDSVRTNHALPLALGHEISGRVVQAGANAAQWLGRAV 99
gi 499703809  25 RWMMTGVGQPMVKEAMEIAAPGAGEVLVEVAGCGVCHTDLDYYYNGVRTNHALPLALGHEISGRVIQAGAGAESWVGKAV 104
gi 499558028   8 TWQMTEPGK-LQKTRVPMPELGSGDVVVKIAGCGVCHTDLSYFYMGVPTVQKPPLSLGHEISGTII---GGEASMIGKEV 83
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 19571180  100 IVPAVMPCGTCELCTSGHGTICRDQVMPGNDIQ--GGFASHVVVPARGLCPVDEARLAAAGLQLADVSVVADAVTTPYQA 177
gi 499703809 105 IISAVIPCGQCDLCKRGKGTICRSQKMPGNDLQ--GGFATHITVPANGLCAVDEARLKAAGLELSEVSVVADALTTPYQA 182
gi 499558028  84 IVPAVIPCGECELCKTGRGNRCLAQKMPGNSMGiyGGYSSHIVAQSKYLCVVEN----RGDTPLEHLAVVADAVTTPYQA 159
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 19571180  178 VLQAGVEPGDVAVVIGV-GGVGGYAVQIANAFGA-SVVAIDVDPAKLEMMSKHGAALTLNAREI-SGRDLKKAIEAHAKA 254
gi 499703809 183 AVQAGIGQGDLVIVIGC-GGVGGYSVQVASAMGA-TVVALDIDPVKLEAVKAAGAKLTLNPKDFpSTREIKKEIGAFAKA 260
gi 499558028 160 AVRADLKKDDLVIVVGAaGGVGSFMVQTAKGMGAkAVIGIDINEEKLEMMKGFGADFIINPKDK-SAKEVKELFKGFCKE 238
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 19571180  255 NGLRLT-RWKIFECSGTGAGQTSAYGLLTHGATLAVVGFTMDKVEVRLSNLMAFHARALGNWGCLPEYYPAALDLVLDKK 333
gi 499703809 261 QGLRST-EWIIMECSGSVPGQQSAFDLMVHGCTICVVGYTMNKAEFRLSNLMAFHARALGNWGCPPDLYPGALDLVLSGK 339
gi 499558028 239 RGLPSNyGWKIFEVTGSKPGQELALSLLSFTGKLVIVGYGTAETNYMLSKLMAFDAEIIGTWGCPPDRYAAVRDMCLDGR 318
                        330       340       350
                 ....*....|....*....|....*....|....*
gi 19571180  334 IDLASFIERHPLDQIGEVFAAAHAHKLTRRAILTP 368
gi 499703809 340 INVKNFVERRPLDSINDTFAAVHDHKLSRRAVLCP 374
gi 499558028 319 IQLGPFVETRPMSQIEHVFDEAHHGKLKRRVILTP 353
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap