Conserved Protein Domain Family
pucB

?
TIGR03202: pucB 
xanthine dehydrogenase accessory protein pucB
In Bacillus subtilis the expression of this protein, located in an operon with the structural subunits of xanthine dehydrogenase, has been found to be essential for XDH activity. Some members of this family appear to have a distant relationship to the MobA protein involved in molybdopterin biosynthesis, although this may be coincidental.
Statistics
?
PSSM-Id: 132246
View PSSM: TIGR03202
Aligned: 4 rows
Threshold Bit Score: 298.654
Threshold Setting Gi: 221311193
Created: 8-Oct-2014
Updated: 11-Oct-2014
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 499567796   3 TVAICLAAGQSARMGEN--KLALPLLETTVGSASLKTALGTDVAKIVVVIGEKyghtSWLD-PKlLA--DRRIMLVCCRK 77
gi 446628941   3 IVGIYLAAGKSRRTGPGlhKLYLPTGNTLLGNKALHTSLSSNLSDVIVVSNQP----SWLL-HY-TQ--VERVHILSCEK 74
gi 499549101   6 IAAIYLAAGQSRRMGAD--KRALPWGDGTLGTAGLKAALRSRLSPVIVVVPPDda-lAWLP-DElRN--HENCRFTRCAD 79
gi 497653932   6 LIGVFLAAGKSRRMGQN--KLALPLKGENIGSLSLKTALSSRLDHVLVVERTEhaslEWIGaPYhAPpfQKRWSLHVCQD 83
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 499567796  78 AAEGQAESLKCGLEVAGALGASAVLILLADQPFLPASVIKSVLATAKRRPDaTSVSACYKGKQRPPALFRQSLFVKLHAL 157
gi 446628941  75 SCLGQSYSLHCGLEKAESMNADGVVVMLADQPFITVKLLNSLIDSYEHLPQlDYVAASFQGIPQPPILFSKGIFPSLKKL 154
gi 499549101  80 HCRGQAHSLACGLRESLASGADAAVVLLADQPFVTADVINALTDLYRRHRP-DYVAFTRFGTPMPPVIFGKQTFPALLAL 158
gi 497653932  84 AEKGQGHSVSSGVRKAESMGADGIVILLADQPQLSVDHLNALVALA---PE-SFAVSSFLGAFTPPIYFSSTCFPYVKGL 159
                        170       180       190
                 ....*....|....*....|....*....|....*....
gi 499567796 158 AGDEGARAV-L--RKDKSSLAVPVADASAFFDIDTKEDY 193
gi 446628941 155 KGDQGARSIfF--DKSFQGKITVYSDAKLFYDVNTIEDY 191
gi 499549101 159 RGDAGGRTL-F--HHPRWRGLLYEGDEtigididtiddy 194
gi 497653932 160 KGDEGARRL-LksGQLGAGAVLEAKDSGELDDIDTPRGI 197
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap