Conserved Protein Domain Family
pimD_small

?
TIGR03203: pimD_small 
pimeloyl-CoA dehydrogenase, small subunit
Members of this protein family are the PimD proteins of species such as Rhodopseudomonas palustris, Bradyrhizobium japonicum. The pimFABCDE operon encodes proteins for the metabolism of straight chain dicarboxylates of seven to fourteen carbons. Especially relevant is pimeloyl-CoA, basis of the gene symbol, as it is a catabolite of benzoyl-CoA degradation, which occurs in Rhodopseudomonas palustris.
Statistics
?
PSSM-Id: 132247
View PSSM: TIGR03203
Aligned: 3 rows
Threshold Bit Score: 734.115
Threshold Setting Gi: 27382928
Created: 8-Oct-2014
Updated: 11-Oct-2014
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 499472611   2 DFDLSEEQRLLKESVEGLLKGSYDFDSRKKYAKEKGGWSRAVWGKFAEQGLLGLPFSEEDGGFGAGAVETMIVMEALGHS 81
gi 499791949   2 DFDLSEEQRLLKDSVEGLLKTSYDFDARKKYQAEPGGWSKTVWSKLAEQGLLGLPFSEADGGFGAGSVETMIVMEALGKA 81
gi 499403074   2 DFDLSEEQRLLKESIDGLLTDSYDFESRKKYMKEKGGWSQAVWGKLAEQGLLGLPFSEADGGFGGGGVETMIVMEALGKA 81
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 499472611  82 LVLEPYLPTVVIGGGFLRRAGSAAQKAAHLPGIIDGSKTFAFAQLEKNSRWDLGDVSTTAKKSGDGWVIDGEKFVVLNGE 161
gi 499791949  82 LVVEPYLATVVLGGGFLRHGGSAEQKAAHLPGLIDGSKTFAFAQLEKNSRYDLGDVTTTAKKTGAMWVLDGEKFVVLHGE 161
gi 499403074  82 LVLEPYLATVVICGGFLRHAGSDAQKAAYVPGIIDGSKTLAFAQLEKNSRYDLFDVSTTAKKKADGWIIDGEKFVVLNGE 161
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 499472611 162 AADTLIVTARTKGGQRDRTGVGVFLVPADAKGITRKGYPTQDGLHAADITFTGVQVGADAAIGDPENALELIEAVVDDAR 241
gi 499791949 162 TADTLIVTARSKGARRDRDGIGVFLVPAGAKGVSIKGYPTQDGLQAADISLSGVVIDADCAIGDPENGLPLVERVVDDAR 241
gi 499403074 162 NAATLLVTARTKGDRRDKTGIGVFLVPANAKGVTKKSYPTQDGLHAADITFTGVEVGADAAIGNPEDALALIERVVDEAR 241
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 499472611 242 TALCAEAVGLMDESLTTTVEYIKTRKQFGVPIGSFQVLQHRAADMFVATEQARSMAMFATMAAEFDDAKERAGAIAAAKV 321
gi 499791949 242 AALCAEAVGAMDESLKSTVDYMKTRTQFGVPIGSFQVLQHRAADMFVAVEQARSMALFATMASDFDDARERANAIAAAKV 321
gi 499403074 242 VALCAEAVGLMDESLKTTVEYIKTRKQFGVAIGSFQSLQHRASDMFVAAEQARSMSMFATMANDFENAKERSNAIAAAKV 321
                        330       340       350       360       370
                 ....*....|....*....|....*....|....*....|....*....|....*...
gi 499472611 322 QIGKSGKFVGQQSIQLHGGIGMTMEAKIGHYFKRLTMIEQTFGDTDHHLARVSAGGGL 379
gi 499791949 322 QVGQSLKFVGEQAIQLHGGVGMTMEYKIGHYFKRLTMIEHAFGDSDFHLSRVSAAGGL 379
gi 499403074 322 QIGKSLKFVGQQSIQLHGGIGMTMEAKIGHYFKRLTMIENTFGDTDYHQRRVADAGGL 379
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap