Conserved Protein Domain Family
pimC_large

?
TIGR03204: pimC_large 
pimeloyl-CoA dehydrogenase, large subunit
Members of this protein family are the PimC proteins of species such as Rhodopseudomonas palustris and Bradyrhizobium japonicum. The pimFABCDE operon encodes proteins for the metabolism of straight chain dicarboxylates of seven to fourteen carbons. Especially relevant is pimeloyl-CoA, basis of the gene symbol, as it is a catabolite of benzoyl-CoA degradation, which occurs in Rhodopseudomonas palustris.
Statistics
?
PSSM-Id: 132248
View PSSM: TIGR03204
Aligned: 3 rows
Threshold Bit Score: 878.199
Threshold Setting Gi: 90423732
Created: 8-Oct-2014
Updated: 11-Oct-2014
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 499472612   2 DLNFSKEEIAFRDEVRQFFKDNVPAKTRQKLIEGRHNTKEEMVEWYRILNKKGWAVTHWPKEYGGTGWSSVQHYIFNEEL 81
gi 499403075   2 DLAFTKEEQAFREEVRSFFRDNVPPDTRRKLVEGRHLSKDEMVTWWRILNKKGWGVSHWPKQYGGTGWTSVQHYIFNEEL 81
gi 499791948   2 DLSFSKDELAFRDEVRAFFKDNVPAALRQKLMEGRHPTKQEMVDWWRVLNAKGWGVPHWPKQYGGTGWTSVQDYIFNEEL 81
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 499472612  82 QAAPAPQPLAFGVSMVGPVIYTFGSEEQKKRFLPRIANVDDWWCQGFSEPGSGSDLASLKTKAEKKGDKWIINGQKTWTT 161
gi 499403075  82 QSYPAPQPLAFGVSMVGPVIYTFGNEEQKKKYLPRIANVDDWWCQGFSEPGSGSDLASLKTKAERKGDKWIINGQKTWTT 161
gi 499791948  82 QMAPAPAPLAFGVSMVGPVIYTFGNEAQKARFLPRIANVDDWWCQGFSEPGSGSDLASLKTKAEKKGDTYIVNGQKTWTT 161
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 499472612 162 LAQHADWIFCLCRTDPAAKKQEGISFILVDMKTKGITVRPIQTIDGGHEVNEVFFDDVEVPLENLVGQENKGWDYAKFLL 241
gi 499403075 162 LAQHADMIFCLCRTDATAKKQMGISFIVFSMKSKGVTVRPIQTIDGGVEVNEVFFDDVEVPYENLIGEENKGWDYAKFLL 241
gi 499791948 162 LAQHADWIFCLCRTDPTAKKQSGISFILVDMKSKGITVRPIQTIDGSSEVNEVFFDDVEVPVENLVGEENKGWDYAKFLL 241
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 499472612 242 GNERTGIARVGMSKERIRRIKQLAAQVESGGKPVIEDPKFRDKLAAVEIELKALELTQLRVVADEGKHGKGKPNPASSVL 321
gi 499403075 242 GNERTGIARVGVSKERLRRIRDLASKVESGGKPIIQDAAFREKLAACEIELKALELTQLRVVADEGKHGKGKPNPASSVL 321
gi 499791948 242 GNERTGIARVGVSKERIKRIKELAAKVQAGGKPVLEDQKFREKLALVEIELKALELTQLRVVANEGKHGKGKPDPASSVL 321
                        330       340       350       360       370       380       390
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 499472612 322 KIKGSEIQQATTELLMEVIGPFAAPYDVHGDDDSNETMDWTAQIAPGYFNNRKVSIYGGSNEIQRNIICKAVLGL 396
gi 499403075 322 KIKGSEIQQTTTELLMEVIGPFAAPYDVHGDDGSNEAMEWTAQIAPSYFNNRKVSIYGGSNEIQRNIIAKAVLGL 396
gi 499791948 322 KIKGSEIQQATTELLMNVIGPFAAPYDIHGDDGSNEAMDWTAQIAPSYFNNRKVSIYGGSNEIQRNIISKAVLGL 396
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap