Conserved Protein Domain Family
pimA

?
TIGR03205: pimA 
dicarboxylate--CoA ligase PimA
PimA, a member of a large family of acyl-CoA ligases, is found in a characteristic operon pimFABCDE for the metabolism of pimelate and related compounds. It is found, so far, in Bradyrhizobium japonicum and several strains of Rhodopseudomonas palustris. PimA from R. palustris was shown to be active as a CoA ligase for C(7) to C(14) dicarboxylates and fatty acids.
Statistics
?
PSSM-Id: 132249
View PSSM: TIGR03205
Aligned: 3 rows
Threshold Bit Score: 1119.66
Threshold Setting Gi: 27382931
Created: 8-Oct-2014
Updated: 11-Oct-2014
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 499403077   2 THPGEQFYPEGVRWDDTIVQGTLPDLLSKAAADYGPRTALEFRERPITYTELAAMAERAAAAFLRAGCGKSASVALFLGN 81
gi 499791946   5 THPGEQFYPAGLTWDAPVARGTLPDLLSTSATRYGARPAIEFRDRAISFTELEALVETAAAALLRAGYGKDCSVGLYLGN 84
gi 499472614   2 SHPGEQYYPPGVRWDAVIARGTLPELLAQAAKDYASRPALEFRDRQITYTKLEAMAETAAAALLAAGYGRDSSVALYIGN 81
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 499403077  82 TPDHPVNFFGALKAGARVAHLSPLDGEIALTHKVSDSGSRLLVTSNLAALLPTALKFLEKGLIDRLVVCEDDNWGKVGTP 161
gi 499791946  85 LPDHPINFFGALKAGARVVHLSPLDGERALSHKLSDSGARILITSDLAGLLPMALKFLEKGLLDRLIVCDDEHWGAVGNP 164
gi 499472614  82 TPDHPINFFGALKAGARVVHLSPLDGERALSHKLSDSGARVLITTDSAALLPMAERFLAKGLLDRLIVCSDASWGESATP 161
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 499403077 162 QAAIPADPRIVTFKTFVEGAAAPAEWPQVTADDVALLQYTGGTTGLPKGAMLTHGNLTSAVSIYDVWGKPSRATRGDVvE 241
gi 499791946 165 HTPIPDDPRIVRYADFTKDATPPAQWPALKPDDVAVLQYTGGTTGLPKGAMLSHGNLTSAVSIYDLWGARDRAERNTV-E 243
gi 499472614 162 LAPLPSDPRVITYADFIKGASKPMAWPAIVPDDIALLQYTGGTTGLPKGAMLTHSNLTSAVAIYDVWGL-VRANSGGI-H 239
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 499403077 242 RVICVLPLFHIYALTVVLLSSLRRGNLISIHQRFDVEAVMRDIEVKRATYFPGVPTMWIAIAALPDLDKRDFSSLATIGS 321
gi 499791946 244 RVICVLPLFHIYALTVILLRSLNNGDLISLHQRFDVAAIFRDIEEKRATVFPGVPTMWIALANDPSLESRDLSSLATCGS 323
gi 499472614 240 RVICVLPLFHIYALTVILLRCLKQGDLISLHQRFDVAAVFRDIEEKRATVFPGVPTMWIALANDPSLEKRDLSSLTMAGS 319
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 499403077 322 GGAPLPVEIANFFERKVGKKLRSGWGMTETCSPGTGHPPTGPDKPGSIGLMLPGIELDVVSLDDPTKVLPPGEVGEIRIK 401
gi 499791946 324 GGAPLPVEVAKVFERKTGLQLKSGWGMTETCSPGTSHPLEGPDKPGSIGLMLPGIELDVVSLDDTSKPLPPGEVGELRIR 403
gi 499472614 320 GGAPLPVEVARLFERKTNLKLKSGWGMTETCSPGTGHPPEGPDKPGSIGLMLPGIELDVVALDDPKRVLPPGEVGELRVR 399
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 499403077 402 GPNVTRGYWNKPEGSAEAFIDGRFLTGDIGYVDTDGYFFLVDRKKDMIISGGFNVYPQMIEQAIYTLPGVHEVIVLGIPD 481
gi 499791946 404 GPNVTRGYWNRAQETAEAFVGDRFLTGDIGTMDRDGYFFLVDRKKDMIICGGFNVYPQMIEQAIYEHPSVQEVIVIGIPD 483
gi 499472614 400 GPNVTKGYWNRPEESAHSFVGDRFLTGDIGYMDQDGYFFLVDRKKDMIISGGFNVYPQMIEQAIYEHPAVQEVIVIGVPD 479
                        490       500       510       520       530       540
                 ....*....|....*....|....*....|....*....|....*....|....*....|..
gi 499403077 482 QYRGEAAKAFIKLKPGAKPFSLDELRAQLAGKVGKHEMPVEVEFVDDLPRTPVGKLSRHELR 543
gi 499791946 484 QYRGEAAKAFVKLRSGAAPFSVDALREFLKGKLGKHELPAALELVDELPRTSVGKLSRHELR 545
gi 499472614 480 DYRGEAAKAFVKLREGAKPFSIDELRAFLTGKLGKHELPTAVEFLDELPRTTVGKLSRHELR 541
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap